Bos javanicus (banteng): 133241617 Help Entry 133241617         CDS       T11659                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism bjv  Bos javanicus (banteng) Pathway bjv04010   MAPK signaling pathway bjv04014   Ras signaling pathway bjv04015   Rap1 signaling pathway bjv04022   cGMP-PKG signaling pathway bjv04066   HIF-1 signaling pathway bjv04068   FoxO signaling pathway bjv04072   Phospholipase D signaling pathway bjv04081   Hormone signaling bjv04114   Oocyte meiosis bjv04140   Autophagy - animal bjv04150   mTOR signaling pathway bjv04151   PI3K-Akt signaling pathway bjv04152   AMPK signaling pathway bjv04211   Longevity regulating pathway bjv04213   Longevity regulating pathway - multiple species bjv04810   Regulation of actin cytoskeleton bjv04910   Insulin signaling pathway bjv04911   Insulin secretion bjv04913   Ovarian steroidogenesis bjv04914   Progesterone-mediated oocyte maturation bjv04917   Prolactin signaling pathway bjv04923   Regulation of lipolysis in adipocytes bjv04930   Type II diabetes mellitus bjv04931   Insulin resistance bjv04932   Non-alcoholic fatty liver disease bjv04940   Type I diabetes mellitus bjv04950   Maturity onset diabetes of the young bjv04960   Aldosterone-regulated sodium reabsorption bjv05010   Alzheimer disease bjv05215   Prostate cancer bjv05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:bjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     133241617 (INS)    04014 Ras signaling pathway     133241617 (INS)    04015 Rap1 signaling pathway     133241617 (INS)    04066 HIF-1 signaling pathway     133241617 (INS)    04068 FoxO signaling pathway     133241617 (INS)    04072 Phospholipase D signaling pathway     133241617 (INS)    04022 cGMP-PKG signaling pathway     133241617 (INS)    04151 PI3K-Akt signaling pathway     133241617 (INS)    04152 AMPK signaling pathway     133241617 (INS)    04150 mTOR signaling pathway     133241617 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     133241617 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     133241617 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     133241617 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     133241617 (INS)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     133241617 (INS)    04910 Insulin signaling pathway     133241617 (INS)    04923 Regulation of lipolysis in adipocytes     133241617 (INS)    04913 Ovarian steroidogenesis     133241617 (INS)    04914 Progesterone-mediated oocyte maturation     133241617 (INS)    04917 Prolactin signaling pathway     133241617 (INS)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     133241617 (INS)   09149 Aging    04211 Longevity regulating pathway     133241617 (INS)    04213 Longevity regulating pathway - multiple species     133241617 (INS)  09160 Human Diseases   09162 Cancer: specific types    05215 Prostate cancer     133241617 (INS)   09164 Neurodegenerative disease    05010 Alzheimer disease     133241617 (INS)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     133241617 (INS)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     133241617 (INS)    04940 Type I diabetes mellitus     133241617 (INS)    04950 Maturity onset diabetes of the young     133241617 (INS)    04932 Non-alcoholic fatty liver disease     133241617 (INS)    04931 Insulin resistance     133241617 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bjv04052]     133241617 (INS) Cytokines and neuropeptides [BR:bjv04052]  Neuropeptides   Unclassified    133241617 (INS) SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  133241617 NCBI-ProteinID:  XP_061263373 LinkDB All DBs Position 29:49774360..49775590 Genome browser AA seq 105 aa AA seqDB search MALWTRLAPLLALLALWAPAPARAFVNQHLCGSHLVEALYLVCGERGFFYTPKARRELEG PQVGALELAGGPGAGGLEGPPQKRGIVEQCCASVCSLYQLENYCN NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggccctgtggacacgcctggcgcccctgctggccctgctggcgctctgggcccccgcc ccggcccgcgccttcgtcaaccagcatctgtgtggctcccacctggtggaggcgctgtac ctggtgtgcggagagcgcggcttcttctacacgcccaaggcccgccgggagctggagggc ccccaggtgggggcgctggagctggccggaggcccgggcgcgggcggcctggaggggccc ccgcagaagcgcggcatcgtggagcagtgctgtgccagcgtctgctcgctctaccagctg gagaactactgtaactag

DBGET integrated database retrieval system