Bos javanicus (banteng): 133243503 Help Entry 133243503         CDS       T11659                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism bjv  Bos javanicus (banteng) Pathway bjv01521   EGFR tyrosine kinase inhibitor resistance bjv01522   Endocrine resistance bjv04010   MAPK signaling pathway bjv04012   ErbB signaling pathway bjv04014   Ras signaling pathway bjv04015   Rap1 signaling pathway bjv04062   Chemokine signaling pathway bjv04068   FoxO signaling pathway bjv04071   Sphingolipid signaling pathway bjv04072   Phospholipase D signaling pathway bjv04137   Mitophagy - animal bjv04140   Autophagy - animal bjv04150   mTOR signaling pathway bjv04151   PI3K-Akt signaling pathway bjv04210   Apoptosis bjv04211   Longevity regulating pathway bjv04213   Longevity regulating pathway - multiple species bjv04218   Cellular senescence bjv04360   Axon guidance bjv04370   VEGF signaling pathway bjv04371   Apelin signaling pathway bjv04519   Cadherin signaling bjv04540   Gap junction bjv04550   Signaling pathways regulating pluripotency of stem cells bjv04625   C-type lectin receptor signaling pathway bjv04650   Natural killer cell mediated cytotoxicity bjv04660   T cell receptor signaling pathway bjv04662   B cell receptor signaling pathway bjv04664   Fc epsilon RI signaling pathway bjv04714   Thermogenesis bjv04720   Long-term potentiation bjv04722   Neurotrophin signaling pathway bjv04725   Cholinergic synapse bjv04726   Serotonergic synapse bjv04730   Long-term depression bjv04810   Regulation of actin cytoskeleton bjv04910   Insulin signaling pathway bjv04912   GnRH signaling pathway bjv04915   Estrogen signaling pathway bjv04916   Melanogenesis bjv04917   Prolactin signaling pathway bjv04919   Thyroid hormone signaling pathway bjv04921   Oxytocin signaling pathway bjv04926   Relaxin signaling pathway bjv04929   GnRH secretion bjv04933   AGE-RAGE signaling pathway in diabetic complications bjv04935   Growth hormone synthesis, secretion and action bjv05010   Alzheimer disease bjv05022   Pathways of neurodegeneration - multiple diseases bjv05034   Alcoholism bjv05160   Hepatitis C bjv05161   Hepatitis B bjv05163   Human cytomegalovirus infection bjv05165   Human papillomavirus infection bjv05166   Human T-cell leukemia virus 1 infection bjv05167   Kaposi sarcoma-associated herpesvirus infection bjv05170   Human immunodeficiency virus 1 infection bjv05200   Pathways in cancer bjv05203   Viral carcinogenesis bjv05205   Proteoglycans in cancer bjv05206   MicroRNAs in cancer bjv05207   Chemical carcinogenesis - receptor activation bjv05208   Chemical carcinogenesis - reactive oxygen species bjv05210   Colorectal cancer bjv05211   Renal cell carcinoma bjv05213   Endometrial cancer bjv05214   Glioma bjv05215   Prostate cancer bjv05216   Thyroid cancer bjv05218   Melanoma bjv05219   Bladder cancer bjv05220   Chronic myeloid leukemia bjv05221   Acute myeloid leukemia bjv05223   Non-small cell lung cancer bjv05224   Breast cancer bjv05225   Hepatocellular carcinoma bjv05226   Gastric cancer bjv05230   Central carbon metabolism in cancer bjv05231   Choline metabolism in cancer bjv05235   PD-L1 expression and PD-1 checkpoint pathway in cancer bjv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     133243503 (NRAS)    04012 ErbB signaling pathway     133243503 (NRAS)    04014 Ras signaling pathway     133243503 (NRAS)    04015 Rap1 signaling pathway     133243503 (NRAS)    04370 VEGF signaling pathway     133243503 (NRAS)    04371 Apelin signaling pathway     133243503 (NRAS)    04068 FoxO signaling pathway     133243503 (NRAS)    04072 Phospholipase D signaling pathway     133243503 (NRAS)    04071 Sphingolipid signaling pathway     133243503 (NRAS)    04151 PI3K-Akt signaling pathway     133243503 (NRAS)    04150 mTOR signaling pathway     133243503 (NRAS)   09133 Signaling molecules and interaction    04519 Cadherin signaling     133243503 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     133243503 (NRAS)    04137 Mitophagy - animal     133243503 (NRAS)   09143 Cell growth and death    04210 Apoptosis     133243503 (NRAS)    04218 Cellular senescence     133243503 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     133243503 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     133243503 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     133243503 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     133243503 (NRAS)    04650 Natural killer cell mediated cytotoxicity     133243503 (NRAS)    04660 T cell receptor signaling pathway     133243503 (NRAS)    04662 B cell receptor signaling pathway     133243503 (NRAS)    04664 Fc epsilon RI signaling pathway     133243503 (NRAS)    04062 Chemokine signaling pathway     133243503 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     133243503 (NRAS)    04929 GnRH secretion     133243503 (NRAS)    04912 GnRH signaling pathway     133243503 (NRAS)    04915 Estrogen signaling pathway     133243503 (NRAS)    04917 Prolactin signaling pathway     133243503 (NRAS)    04921 Oxytocin signaling pathway     133243503 (NRAS)    04926 Relaxin signaling pathway     133243503 (NRAS)    04935 Growth hormone synthesis, secretion and action     133243503 (NRAS)    04919 Thyroid hormone signaling pathway     133243503 (NRAS)    04916 Melanogenesis     133243503 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     133243503 (NRAS)    04726 Serotonergic synapse     133243503 (NRAS)    04720 Long-term potentiation     133243503 (NRAS)    04730 Long-term depression     133243503 (NRAS)    04722 Neurotrophin signaling pathway     133243503 (NRAS)   09158 Development and regeneration    04360 Axon guidance     133243503 (NRAS)   09149 Aging    04211 Longevity regulating pathway     133243503 (NRAS)    04213 Longevity regulating pathway - multiple species     133243503 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     133243503 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     133243503 (NRAS)    05206 MicroRNAs in cancer     133243503 (NRAS)    05205 Proteoglycans in cancer     133243503 (NRAS)    05207 Chemical carcinogenesis - receptor activation     133243503 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     133243503 (NRAS)    05203 Viral carcinogenesis     133243503 (NRAS)    05230 Central carbon metabolism in cancer     133243503 (NRAS)    05231 Choline metabolism in cancer     133243503 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     133243503 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     133243503 (NRAS)    05225 Hepatocellular carcinoma     133243503 (NRAS)    05226 Gastric cancer     133243503 (NRAS)    05214 Glioma     133243503 (NRAS)    05216 Thyroid cancer     133243503 (NRAS)    05221 Acute myeloid leukemia     133243503 (NRAS)    05220 Chronic myeloid leukemia     133243503 (NRAS)    05218 Melanoma     133243503 (NRAS)    05211 Renal cell carcinoma     133243503 (NRAS)    05219 Bladder cancer     133243503 (NRAS)    05215 Prostate cancer     133243503 (NRAS)    05213 Endometrial cancer     133243503 (NRAS)    05224 Breast cancer     133243503 (NRAS)    05223 Non-small cell lung cancer     133243503 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     133243503 (NRAS)    05170 Human immunodeficiency virus 1 infection     133243503 (NRAS)    05161 Hepatitis B     133243503 (NRAS)    05160 Hepatitis C     133243503 (NRAS)    05163 Human cytomegalovirus infection     133243503 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     133243503 (NRAS)    05165 Human papillomavirus infection     133243503 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     133243503 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     133243503 (NRAS)   09165 Substance dependence    05034 Alcoholism     133243503 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     133243503 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     133243503 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     133243503 (NRAS)    01522 Endocrine resistance     133243503 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bjv04131]     133243503 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bjv04147]     133243503 (NRAS)    04031 GTP-binding proteins [BR:bjv04031]     133243503 (NRAS) Membrane trafficking [BR:bjv04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     133243503 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     133243503 (NRAS) Exosome [BR:bjv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    133243503 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    133243503 (NRAS)   Exosomal proteins of breast cancer cells    133243503 (NRAS)   Exosomal proteins of colorectal cancer cells    133243503 (NRAS) GTP-binding proteins [BR:bjv04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     133243503 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  133243503 NCBI-ProteinID:  XP_061266450 LinkDB All DBs Position 3:28913907..28941113 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagtgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcctac cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctgga caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctttgt gtgtttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagata aagcgtgtaaaggactcggatgatgtacctatggtgctagtaggaaacaagtgtgatttg ccaacaaggacagttgacacaaaacaagcccatgaactggccaaaagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta agagaaatacgtcagtaccgaatgaaaaagctcaacagcagtgatgatggcactcaaggc tgtatggggttgccgtgtgtggtgatgtaa

DBGET integrated database retrieval system