Bos javanicus (banteng): 133250468 Help Entry 133250468         CDS       T11659                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism bjv  Bos javanicus (banteng) Pathway bjv04140   Autophagy - animal bjv04144   Endocytosis bjv04152   AMPK signaling pathway bjv04530   Tight junction bjv04972   Pancreatic secretion bjv05014   Amyotrophic lateral sclerosis bjv05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:bjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     133250468 (RAB8A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     133250468 (RAB8A)    04140 Autophagy - animal     133250468 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     133250468 (RAB8A)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     133250468 (RAB8A)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     133250468 (RAB8A)    05022 Pathways of neurodegeneration - multiple diseases     133250468 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bjv04131]     133250468 (RAB8A)    03036 Chromosome and associated proteins [BR:bjv03036]     133250468 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bjv04147]     133250468 (RAB8A)    04031 GTP-binding proteins [BR:bjv04031]     133250468 (RAB8A) Membrane trafficking [BR:bjv04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     133250468 (RAB8A)  Autophagy   Other autophagy associated proteins     133250468 (RAB8A) Chromosome and associated proteins [BR:bjv03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     133250468 (RAB8A) Exosome [BR:bjv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    133250468 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    133250468 (RAB8A)   Exosomal proteins of colorectal cancer cells    133250468 (RAB8A) GTP-binding proteins [BR:bjv04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     133250468 (RAB8A) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 Septin DUF3963 DUF6974 AAA_7 Motif Other DBs NCBI-GeneID:  133250468 NCBI-ProteinID:  XP_061277742 LinkDB All DBs Position 7:complement(6931074..6951667) Genome browser AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFYTLARDIKAKMDKKLEGN SPQGSNQGVKITPDQQKRSSFFRCVLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg aagacctgtgtcctgttccgcttctccgaggacgccttcaactccactttcatctccacc ataggaattgactttaaaattaggaccatagagctcgatggcaagagaattaagctacag atatgggacacagctggtcaggaacggtttcggacgatcacaacggcctactacaggggt gcaatgggcatcatgctggtctacgacatcaccaacgagaagtcctttgataacatccgg aactggattcggaacattgaagagcacgcctctgcagacgtcgaaaagatgatccttggg aacaagtgcgacgtgaatgacaagagacaagtttccaaggaacggggagaaaagctggcc ctggactatggaatcaagttcatggagacaagcgcaaaggccaacatcaacgtggagaac gcattttacactctcgccagagacatcaaagcaaaaatggataaaaaattggaaggcaac agcccccaggggagcaaccaaggagtcaaaatcaccccggaccagcagaagaggagcagc ttcttccgatgtgttcttctgtga

DBGET integrated database retrieval system