Bos javanicus (banteng): 133252533 Help Entry 133252533         CDS       T11659                                  Name (RefSeq) interferon alpha-1-like   KO K05414   interferon alpha Organism bjv  Bos javanicus (banteng) Pathway bjv04060   Cytokine-cytokine receptor interaction bjv04151   PI3K-Akt signaling pathway bjv04217   Necroptosis bjv04620   Toll-like receptor signaling pathway bjv04621   NOD-like receptor signaling pathway bjv04622   RIG-I-like receptor signaling pathway bjv04623   Cytosolic DNA-sensing pathway bjv04630   JAK-STAT signaling pathway bjv04650   Natural killer cell mediated cytotoxicity bjv04936   Alcoholic liver disease bjv05152   Tuberculosis bjv05160   Hepatitis C bjv05161   Hepatitis B bjv05162   Measles bjv05163   Human cytomegalovirus infection bjv05164   Influenza A bjv05165   Human papillomavirus infection bjv05167   Kaposi sarcoma-associated herpesvirus infection bjv05168   Herpes simplex virus 1 infection bjv05169   Epstein-Barr virus infection bjv05170   Human immunodeficiency virus 1 infection bjv05171   Coronavirus disease - COVID-19 bjv05200   Pathways in cancer bjv05320   Autoimmune thyroid disease bjv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     133252533    04151 PI3K-Akt signaling pathway     133252533   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     133252533  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     133252533  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     133252533    04621 NOD-like receptor signaling pathway     133252533    04622 RIG-I-like receptor signaling pathway     133252533    04623 Cytosolic DNA-sensing pathway     133252533    04650 Natural killer cell mediated cytotoxicity     133252533  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     133252533   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     133252533    05161 Hepatitis B     133252533    05160 Hepatitis C     133252533    05171 Coronavirus disease - COVID-19     133252533    05164 Influenza A     133252533    05162 Measles     133252533    05168 Herpes simplex virus 1 infection     133252533    05163 Human cytomegalovirus infection     133252533    05167 Kaposi sarcoma-associated herpesvirus infection     133252533    05169 Epstein-Barr virus infection     133252533    05165 Human papillomavirus infection     133252533   09171 Infectious disease: bacterial    05152 Tuberculosis     133252533   09163 Immune disease    05320 Autoimmune thyroid disease     133252533   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     133252533   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     133252533  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bjv04052]     133252533 Cytokines and neuropeptides [BR:bjv04052]  Cytokines   Interferons    133252533 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon HI_1489_N Motif Other DBs NCBI-GeneID:  133252533 NCBI-ProteinID:  XP_061281161 LinkDB All DBs Position 8:23641123..23642272 Genome browser AA seq 189 aa AA seqDB search MAPAWSFLLALLLLSCNAICSLGCHQPHSHSLANRRVLTLLRQLRRVSPSSCLQDRNDFS FPQEVLHGSQLQKAQAISVLHEVTQHTFQLFSTEGSATMWDESLLDKLRTALDQQLTDLQ ACLRQEEGLPGAPLLKEDSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAQVMRAFSSSTN LQERFRRKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccccagcctggtccttcctcctggcactgctgctgctcagctgcaacgccatctgc tctctgggctgccaccagcctcactcccacagcctggccaacaggagggtcctgacgctc ctgcgacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgacttctca ttcccccaggaggtgctgcatggcagccagttgcagaaggctcaggccatctctgtgctc cacgaggtgacccagcacaccttccagctcttcagcacagagggctcggccaccatgtgg gatgagagcctcctggacaagctccgcactgcactggatcagcagctcactgacctgcaa gcctgtctgaggcaggaggaggggctgccaggggctcccctgctcaaggaggactccagc ctggctgtgaggaaatacttccacagactcactctctatctgcaagagaagagacacagc ccttgtgcctgggaggttgtcagagcacaagtcatgagagccttctcctcctcaaccaac ttgcaggagagattcaggagaaaggactga

DBGET integrated database retrieval system