Bos javanicus (banteng): 133253092 Help Entry 133253092         CDS       T11659                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism bjv  Bos javanicus (banteng) Pathway bjv04010   MAPK signaling pathway bjv04020   Calcium signaling pathway bjv04022   cGMP-PKG signaling pathway bjv04114   Oocyte meiosis bjv04218   Cellular senescence bjv04310   Wnt signaling pathway bjv04360   Axon guidance bjv04370   VEGF signaling pathway bjv04380   Osteoclast differentiation bjv04625   C-type lectin receptor signaling pathway bjv04650   Natural killer cell mediated cytotoxicity bjv04658   Th1 and Th2 cell differentiation bjv04659   Th17 cell differentiation bjv04660   T cell receptor signaling pathway bjv04662   B cell receptor signaling pathway bjv04720   Long-term potentiation bjv04724   Glutamatergic synapse bjv04921   Oxytocin signaling pathway bjv04922   Glucagon signaling pathway bjv04924   Renin secretion bjv05010   Alzheimer disease bjv05014   Amyotrophic lateral sclerosis bjv05020   Prion disease bjv05022   Pathways of neurodegeneration - multiple diseases bjv05031   Amphetamine addiction bjv05152   Tuberculosis bjv05163   Human cytomegalovirus infection bjv05166   Human T-cell leukemia virus 1 infection bjv05167   Kaposi sarcoma-associated herpesvirus infection bjv05170   Human immunodeficiency virus 1 infection bjv05235   PD-L1 expression and PD-1 checkpoint pathway in cancer bjv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     133253092 (PPP3R2)    04310 Wnt signaling pathway     133253092 (PPP3R2)    04370 VEGF signaling pathway     133253092 (PPP3R2)    04020 Calcium signaling pathway     133253092 (PPP3R2)    04022 cGMP-PKG signaling pathway     133253092 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     133253092 (PPP3R2)    04218 Cellular senescence     133253092 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     133253092 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     133253092 (PPP3R2)    04660 T cell receptor signaling pathway     133253092 (PPP3R2)    04658 Th1 and Th2 cell differentiation     133253092 (PPP3R2)    04659 Th17 cell differentiation     133253092 (PPP3R2)    04662 B cell receptor signaling pathway     133253092 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     133253092 (PPP3R2)    04921 Oxytocin signaling pathway     133253092 (PPP3R2)    04924 Renin secretion     133253092 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     133253092 (PPP3R2)    04720 Long-term potentiation     133253092 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     133253092 (PPP3R2)    04380 Osteoclast differentiation     133253092 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     133253092 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     133253092 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     133253092 (PPP3R2)    05163 Human cytomegalovirus infection     133253092 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     133253092 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     133253092 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     133253092 (PPP3R2)    05014 Amyotrophic lateral sclerosis     133253092 (PPP3R2)    05020 Prion disease     133253092 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     133253092 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     133253092 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     133253092 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:bjv01009]     133253092 (PPP3R2) Protein phosphatases and associated proteins [BR:bjv01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      133253092 (PPP3R2) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_FSTL1 EF_SSP120 SPARC_Ca_bdg EH EF-hand_9 YtfJ_HI0045 USP32_N Motif Other DBs NCBI-GeneID:  133253092 NCBI-ProteinID:  XP_061282338 LinkDB All DBs Position 8:complement(92008196..92009193) Genome browser AA seq 170 aa AA seqDB search MGNEASYPAEICSHFDEDEIKRLRKRFKKLDLDSSSALSVKEFTSMPELQENPLVQRVID VFDTDGDGQVDFREFILGTSQFSVRGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMV GDNLKDWQLQQLVDKTIILLDKDGDGKISFQEFSAVVRSLEVHKHLVTIV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaggccagttacccggcggagatatgctcgcacttcgacgaagatgaaatt aaaaggctgcgcaagcgttttaagaagctggacttggacagttccagcgctctgagcgtc aaagagttcacgtccatgccggagctgcaggagaacccgctggtgcagcgggtgatcgac gtcttcgacaccgacggcgacggacaggtggacttccgggaattcatcctggggacctcc cagttcagcgtccggggagatgaggagcagaagctgaggtttgctttcagcatctacgac atggacaaagacggctacatttccaacggggagctcttccaggtgctgaagatgatggta ggcgacaacctgaaagactggcagttacagcagctggtggacaaaaccatcatcctcctg gacaaagacggggacgggaaaatctccttccaggaattcagtgctgtggtcagaagcctg gaggtccacaagcacttggtgaccattgtgtga

DBGET integrated database retrieval system