KEGG   Bubalus kerabau (carabao): 129629641
Entry
129629641         CDS       T11435                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1 isoform X1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
bke  Bubalus kerabau (carabao)
Pathway
bke01521  EGFR tyrosine kinase inhibitor resistance
bke01522  Endocrine resistance
bke01524  Platinum drug resistance
bke04010  MAPK signaling pathway
bke04012  ErbB signaling pathway
bke04014  Ras signaling pathway
bke04015  Rap1 signaling pathway
bke04022  cGMP-PKG signaling pathway
bke04024  cAMP signaling pathway
bke04062  Chemokine signaling pathway
bke04066  HIF-1 signaling pathway
bke04068  FoxO signaling pathway
bke04071  Sphingolipid signaling pathway
bke04072  Phospholipase D signaling pathway
bke04114  Oocyte meiosis
bke04140  Autophagy - animal
bke04148  Efferocytosis
bke04150  mTOR signaling pathway
bke04151  PI3K-Akt signaling pathway
bke04210  Apoptosis
bke04218  Cellular senescence
bke04261  Adrenergic signaling in cardiomyocytes
bke04270  Vascular smooth muscle contraction
bke04350  TGF-beta signaling pathway
bke04360  Axon guidance
bke04370  VEGF signaling pathway
bke04371  Apelin signaling pathway
bke04380  Osteoclast differentiation
bke04510  Focal adhesion
bke04517  IgSF CAM signaling
bke04520  Adherens junction
bke04540  Gap junction
bke04550  Signaling pathways regulating pluripotency of stem cells
bke04611  Platelet activation
bke04613  Neutrophil extracellular trap formation
bke04620  Toll-like receptor signaling pathway
bke04621  NOD-like receptor signaling pathway
bke04625  C-type lectin receptor signaling pathway
bke04650  Natural killer cell mediated cytotoxicity
bke04657  IL-17 signaling pathway
bke04658  Th1 and Th2 cell differentiation
bke04659  Th17 cell differentiation
bke04660  T cell receptor signaling pathway
bke04662  B cell receptor signaling pathway
bke04664  Fc epsilon RI signaling pathway
bke04666  Fc gamma R-mediated phagocytosis
bke04668  TNF signaling pathway
bke04713  Circadian entrainment
bke04720  Long-term potentiation
bke04722  Neurotrophin signaling pathway
bke04723  Retrograde endocannabinoid signaling
bke04724  Glutamatergic synapse
bke04725  Cholinergic synapse
bke04726  Serotonergic synapse
bke04730  Long-term depression
bke04810  Regulation of actin cytoskeleton
bke04910  Insulin signaling pathway
bke04912  GnRH signaling pathway
bke04914  Progesterone-mediated oocyte maturation
bke04915  Estrogen signaling pathway
bke04916  Melanogenesis
bke04917  Prolactin signaling pathway
bke04919  Thyroid hormone signaling pathway
bke04921  Oxytocin signaling pathway
bke04926  Relaxin signaling pathway
bke04928  Parathyroid hormone synthesis, secretion and action
bke04929  GnRH secretion
bke04930  Type II diabetes mellitus
bke04933  AGE-RAGE signaling pathway in diabetic complications
bke04934  Cushing syndrome
bke04935  Growth hormone synthesis, secretion and action
bke04960  Aldosterone-regulated sodium reabsorption
bke05010  Alzheimer disease
bke05020  Prion disease
bke05022  Pathways of neurodegeneration - multiple diseases
bke05034  Alcoholism
bke05132  Salmonella infection
bke05133  Pertussis
bke05135  Yersinia infection
bke05140  Leishmaniasis
bke05142  Chagas disease
bke05145  Toxoplasmosis
bke05152  Tuberculosis
bke05160  Hepatitis C
bke05161  Hepatitis B
bke05163  Human cytomegalovirus infection
bke05164  Influenza A
bke05165  Human papillomavirus infection
bke05166  Human T-cell leukemia virus 1 infection
bke05167  Kaposi sarcoma-associated herpesvirus infection
bke05170  Human immunodeficiency virus 1 infection
bke05171  Coronavirus disease - COVID-19
bke05200  Pathways in cancer
bke05203  Viral carcinogenesis
bke05205  Proteoglycans in cancer
bke05206  MicroRNAs in cancer
bke05207  Chemical carcinogenesis - receptor activation
bke05208  Chemical carcinogenesis - reactive oxygen species
bke05210  Colorectal cancer
bke05211  Renal cell carcinoma
bke05212  Pancreatic cancer
bke05213  Endometrial cancer
bke05214  Glioma
bke05215  Prostate cancer
bke05216  Thyroid cancer
bke05218  Melanoma
bke05219  Bladder cancer
bke05220  Chronic myeloid leukemia
bke05221  Acute myeloid leukemia
bke05223  Non-small cell lung cancer
bke05224  Breast cancer
bke05225  Hepatocellular carcinoma
bke05226  Gastric cancer
bke05230  Central carbon metabolism in cancer
bke05231  Choline metabolism in cancer
bke05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bke05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bke00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    129629641 (MAPK1)
   04012 ErbB signaling pathway
    129629641 (MAPK1)
   04014 Ras signaling pathway
    129629641 (MAPK1)
   04015 Rap1 signaling pathway
    129629641 (MAPK1)
   04350 TGF-beta signaling pathway
    129629641 (MAPK1)
   04370 VEGF signaling pathway
    129629641 (MAPK1)
   04371 Apelin signaling pathway
    129629641 (MAPK1)
   04668 TNF signaling pathway
    129629641 (MAPK1)
   04066 HIF-1 signaling pathway
    129629641 (MAPK1)
   04068 FoxO signaling pathway
    129629641 (MAPK1)
   04072 Phospholipase D signaling pathway
    129629641 (MAPK1)
   04071 Sphingolipid signaling pathway
    129629641 (MAPK1)
   04024 cAMP signaling pathway
    129629641 (MAPK1)
   04022 cGMP-PKG signaling pathway
    129629641 (MAPK1)
   04151 PI3K-Akt signaling pathway
    129629641 (MAPK1)
   04150 mTOR signaling pathway
    129629641 (MAPK1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    129629641 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    129629641 (MAPK1)
   04148 Efferocytosis
    129629641 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    129629641 (MAPK1)
   04210 Apoptosis
    129629641 (MAPK1)
   04218 Cellular senescence
    129629641 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    129629641 (MAPK1)
   04520 Adherens junction
    129629641 (MAPK1)
   04540 Gap junction
    129629641 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    129629641 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    129629641 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    129629641 (MAPK1)
   04613 Neutrophil extracellular trap formation
    129629641 (MAPK1)
   04620 Toll-like receptor signaling pathway
    129629641 (MAPK1)
   04621 NOD-like receptor signaling pathway
    129629641 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    129629641 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    129629641 (MAPK1)
   04660 T cell receptor signaling pathway
    129629641 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    129629641 (MAPK1)
   04659 Th17 cell differentiation
    129629641 (MAPK1)
   04657 IL-17 signaling pathway
    129629641 (MAPK1)
   04662 B cell receptor signaling pathway
    129629641 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    129629641 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    129629641 (MAPK1)
   04062 Chemokine signaling pathway
    129629641 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    129629641 (MAPK1)
   04929 GnRH secretion
    129629641 (MAPK1)
   04912 GnRH signaling pathway
    129629641 (MAPK1)
   04915 Estrogen signaling pathway
    129629641 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    129629641 (MAPK1)
   04917 Prolactin signaling pathway
    129629641 (MAPK1)
   04921 Oxytocin signaling pathway
    129629641 (MAPK1)
   04926 Relaxin signaling pathway
    129629641 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    129629641 (MAPK1)
   04919 Thyroid hormone signaling pathway
    129629641 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    129629641 (MAPK1)
   04916 Melanogenesis
    129629641 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    129629641 (MAPK1)
   04270 Vascular smooth muscle contraction
    129629641 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    129629641 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    129629641 (MAPK1)
   04725 Cholinergic synapse
    129629641 (MAPK1)
   04726 Serotonergic synapse
    129629641 (MAPK1)
   04720 Long-term potentiation
    129629641 (MAPK1)
   04730 Long-term depression
    129629641 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    129629641 (MAPK1)
   04722 Neurotrophin signaling pathway
    129629641 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    129629641 (MAPK1)
   04380 Osteoclast differentiation
    129629641 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    129629641 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    129629641 (MAPK1)
   05206 MicroRNAs in cancer
    129629641 (MAPK1)
   05205 Proteoglycans in cancer
    129629641 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    129629641 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    129629641 (MAPK1)
   05203 Viral carcinogenesis
    129629641 (MAPK1)
   05230 Central carbon metabolism in cancer
    129629641 (MAPK1)
   05231 Choline metabolism in cancer
    129629641 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    129629641 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    129629641 (MAPK1)
   05212 Pancreatic cancer
    129629641 (MAPK1)
   05225 Hepatocellular carcinoma
    129629641 (MAPK1)
   05226 Gastric cancer
    129629641 (MAPK1)
   05214 Glioma
    129629641 (MAPK1)
   05216 Thyroid cancer
    129629641 (MAPK1)
   05221 Acute myeloid leukemia
    129629641 (MAPK1)
   05220 Chronic myeloid leukemia
    129629641 (MAPK1)
   05218 Melanoma
    129629641 (MAPK1)
   05211 Renal cell carcinoma
    129629641 (MAPK1)
   05219 Bladder cancer
    129629641 (MAPK1)
   05215 Prostate cancer
    129629641 (MAPK1)
   05213 Endometrial cancer
    129629641 (MAPK1)
   05224 Breast cancer
    129629641 (MAPK1)
   05223 Non-small cell lung cancer
    129629641 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    129629641 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    129629641 (MAPK1)
   05161 Hepatitis B
    129629641 (MAPK1)
   05160 Hepatitis C
    129629641 (MAPK1)
   05171 Coronavirus disease - COVID-19
    129629641 (MAPK1)
   05164 Influenza A
    129629641 (MAPK1)
   05163 Human cytomegalovirus infection
    129629641 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    129629641 (MAPK1)
   05165 Human papillomavirus infection
    129629641 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    129629641 (MAPK1)
   05135 Yersinia infection
    129629641 (MAPK1)
   05133 Pertussis
    129629641 (MAPK1)
   05152 Tuberculosis
    129629641 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    129629641 (MAPK1)
   05140 Leishmaniasis
    129629641 (MAPK1)
   05142 Chagas disease
    129629641 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    129629641 (MAPK1)
   05020 Prion disease
    129629641 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    129629641 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    129629641 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    129629641 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    129629641 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    129629641 (MAPK1)
   04934 Cushing syndrome
    129629641 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    129629641 (MAPK1)
   01524 Platinum drug resistance
    129629641 (MAPK1)
   01522 Endocrine resistance
    129629641 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bke01001]
    129629641 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bke03036]
    129629641 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bke04147]
    129629641 (MAPK1)
Enzymes [BR:bke01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     129629641 (MAPK1)
Protein kinases [BR:bke01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   129629641 (MAPK1)
Chromosome and associated proteins [BR:bke03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     129629641 (MAPK1)
Exosome [BR:bke04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   129629641 (MAPK1)
SSDB
Other DBs
NCBI-GeneID: 129629641
NCBI-ProteinID: XP_055405732
LinkDB
Position
16:76185027..76241429
AA seq 360 aa
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPVAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgac
gtggggccgcgctacaccaatctctcgtacatcggcgagggcgcctacggcatggtgtgc
tctgcttatgacaatgtcaacaaagtccgagtcgccatcaagaaaatcagcccttttgag
caccagacgtactgccagagaacgctgagagagataaagatcttactgcgcttcagacat
gagaacatcatcggaatcaatgacattattcgagcacccaccatcgagcagatgaaagat
gtgtatatagtacaggacctcatggaaacagatctctacaagctcttgaagacgcaacac
ctcagcaacgaccatatctgctattttctttaccagatcctcagagggttaaagtatatt
cattcagccaacgtgctgcaccgtgacctcaaaccttccaacctgctgctcaacaccacc
tgcgatctcaagatctgtgactttggcttggcccgtgttgcagatccggaccacgaccac
acagggttcctgacagagtacgtggccactcgctggtaccgggctccagaaatcatgttg
aattccaagggctacaccaagtccatcgacatctggtccgtcggctgcatcctcgccgag
atgctctccaacaggcccatcttccccgggaagcattacctcgaccagctgaaccacatt
ctgggtattcttggatccccgtcgcaggaagacctgaattgtataataaatttaaaagct
agaaactacctgctctctcttccacacaaaaataaggtgccatggaacaggctgttcccg
aacgcggactccaaagctctggatctactggacaaaatgttgacgttcaaccctcacaag
aggattgaggtggagcaggctctggcccatccttacctggagcagtactacgacccgagc
gatgagcccgtcgccgaagcacccttcaagtttgacatggaattggatgacttgcccaag
gaaaagctcaaagaactcatttttgaagagactgctagattccagccgggataccgatct
taa

DBGET integrated database retrieval system