Bubalus kerabau (carabao): 129637599 Help Entry 129637599         CDS       T11435                                  Symbol MYL11 Name (RefSeq) myosin regulatory light chain 11   KO K12758   fast skeletal myosin light chain 2 Organism bke  Bubalus kerabau (carabao) Pathway bke04510   Focal adhesion bke04520   Adherens junction bke04670   Leukocyte transendothelial migration bke04810   Regulation of actin cytoskeleton bke04814   Motor proteins bke04820   Cytoskeleton in muscle cells bke05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bke00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     129637599 (MYL11)    04520 Adherens junction     129637599 (MYL11)   09142 Cell motility    04814 Motor proteins     129637599 (MYL11)    04820 Cytoskeleton in muscle cells     129637599 (MYL11)    04810 Regulation of actin cytoskeleton     129637599 (MYL11)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     129637599 (MYL11)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129637599 (MYL11)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:bke04812]     129637599 (MYL11)    04147 Exosome [BR:bke04147]     129637599 (MYL11) Cytoskeleton proteins [BR:bke04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      129637599 (MYL11) Exosome [BR:bke04147]  Exosomal proteins   Exosomal proteins of hepatic cells    129637599 (MYL11) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 CFAP251_C EF_EFCAB10_C SAPC2_N AIF-1 Motif Other DBs NCBI-GeneID:  129637599 NCBI-ProteinID:  XP_055417789 LinkDB All DBs Position 23 Genome browser AA seq 170 aa AA seqDB search MAPKKAKRRAVAEGGSSNVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGR LNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKQF LEELLTTQCDRFSKEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atggcacccaagaaggccaagagaagggcagtggcagagggcggaagctccaatgtcttc tccatgtttgatcagacccaaatccaggagttcaaggaggccttcacagtaattgaccag aaccgggatggcattattgacaaggaagacctgcgggacacttttgcagccatggggcgt ctcaatgtgaagaatgaggagctagatgccatgatgaaggaagccagtgggcccatcaac ttcactgtcttcctgaccatgtttggggagaagctcaaaggtgccgaccctgaggatgtg atcactggagccttcaaggtcttagaccctgagggaaaaggcaccatcaagaagcaattc ctggaggagctgctgaccacgcagtgtgaccgcttctccaaggaagagatcaagaacatg tgggctgccttcccccccgacgtgggcggcaacgtagactacaagaacatctgctacgtc atcacgcatggcgacgccaaggaccaggagtag

DBGET integrated database retrieval system