Bubalus kerabau (carabao): 129644369 Help Entry 129644369         CDS       T11435                                  Symbol RAB5A Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism bke  Bubalus kerabau (carabao) Pathway bke04014   Ras signaling pathway bke04137   Mitophagy - animal bke04144   Endocytosis bke04145   Phagocytosis bke04148   Efferocytosis bke04962   Vasopressin-regulated water reabsorption bke05014   Amyotrophic lateral sclerosis bke05022   Pathways of neurodegeneration - multiple diseases bke05132   Salmonella infection bke05146   Amoebiasis bke05152   Tuberculosis Brite KEGG Orthology (KO) [BR:bke00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     129644369 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     129644369 (RAB5A)    04145 Phagocytosis     129644369 (RAB5A)    04137 Mitophagy - animal     129644369 (RAB5A)    04148 Efferocytosis     129644369 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     129644369 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129644369 (RAB5A)    05152 Tuberculosis     129644369 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     129644369 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     129644369 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     129644369 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bke04131]     129644369 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bke04147]     129644369 (RAB5A)    04031 GTP-binding proteins [BR:bke04031]     129644369 (RAB5A) Membrane trafficking [BR:bke04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     129644369 (RAB5A)  Endosome - Lysosome transport     129644369 (RAB5A) Exosome [BR:bke04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129644369 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    129644369 (RAB5A)   Exosomal proteins of colorectal cancer cells    129644369 (RAB5A)   Exosomal proteins of bladder cancer cells    129644369 (RAB5A) GTP-binding proteins [BR:bke04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     129644369 (RAB5A) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 BrnT_toxin Motif Other DBs NCBI-GeneID:  129644369 NCBI-ProteinID:  XP_055426006 LinkDB All DBs Position 2 Genome browser AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSARGRGVDLAEPAQPARGQCCGN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacaagacccaacgggccaaatactggaaataaaatatgccag ttcaaactagtacttctgggagagtctgctgttggcaaatcaagccttgtgcttcgtttt gtgaagggccagtttcatgaatttcaagagagtaccattggggctgcttttctgactcaa acggtatgtcttgatgacacgacagtaaaatttgaaatatgggacacggctggccaagag cggtaccacagcctggcgcccatgtactacagaggcgcccaggccgccatagtcgtgtac gacatcacgaacgaggagtcctttgccagagccaaaaactgggttaaagagcttcagagg caagccagtcctaacattgtaatagctttatcaggaaacaaggccgatctggcaaataaa agagctgtcgactttcaggaggcacagtcctatgcggatgataacagtttattatttatg gagacatcagctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaag ttgccaaagaacgaaccacagaatccaggagcgaactcggccagaggcagaggagtggac ctcgcggagcccgcccagcccgccaggggccagtgctgcggcaactga

DBGET integrated database retrieval system