Bubalus kerabau (carabao): 129644889 Help Entry 129644889         CDS       T11435                                  Symbol SST Name (RefSeq) somatostatin   KO K05237   somatostatin Organism bke  Bubalus kerabau (carabao) Pathway bke04024   cAMP signaling pathway bke04080   Neuroactive ligand-receptor interaction bke04081   Hormone signaling bke04935   Growth hormone synthesis, secretion and action bke04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:bke00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     129644889 (SST)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     129644889 (SST)    04081 Hormone signaling     129644889 (SST)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     129644889 (SST)   09154 Digestive system    04971 Gastric acid secretion     129644889 (SST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bke04052]     129644889 (SST) Cytokines and neuropeptides [BR:bke04052]  Neuropeptides   GPCR binding    129644889 (SST) SSDB OrthologParalogGFIT Motif Pfam:  Somatostatin NLRC4_HD2 Motif Other DBs NCBI-GeneID:  129644889 NCBI-ProteinID:  XP_055426286 LinkDB All DBs Position 2 Genome browser AA seq 116 aa AA seqDB search MLSCRLQCALAALSIVLALGGVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctgtcctgccgcctccagtgcgcgctggccgcgctctccatcgtcctggctcttggc ggtgtcaccggcgcgccctcggatccccggctccgtcagtttctgcagaaatccctggct gctgccgctggcaagcaggaactggccaagtacttcttggcagagctgctgtctgaaccc aaccagacagagaacgatgccctggagcctgaagatttgtcccaggctgctgagcaggat gaaatgaggctggagctgcagagatctgctaactcaaacccggccatggcaccccgagaa cgcaaagctggctgcaagaatttcttctggaagactttcacatcctgttaa

DBGET integrated database retrieval system