Bubalus kerabau (carabao): 129645578 Help Entry 129645578         CDS       T11435                                  Name (RefSeq) histone H3.1-like   KO K11253   histone H3 Organism bke  Bubalus kerabau (carabao) Pathway bke04613   Neutrophil extracellular trap formation bke05034   Alcoholism bke05202   Transcriptional misregulation in cancer bke05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bke00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     129645578  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     129645578   09163 Immune disease    05322 Systemic lupus erythematosus     129645578   09165 Substance dependence    05034 Alcoholism     129645578  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bke03036]     129645578   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bke04147]     129645578 Chromosome and associated proteins [BR:bke03036]  Eukaryotic type   Nucleosome assembly factors    Histones     129645578 Exosome [BR:bke04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129645578 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone YebU_pre-PUA_dom CENP-S CBFD_NFYB_HMF CENP-T_C PAF TMA7 TFIID-31kDa Motif Other DBs NCBI-GeneID:  129645578 NCBI-ProteinID:  XP_055426853 LinkDB All DBs Position 3:20661323..20663277 Genome browser AA seq 132 aa AA seqDB search MARTKQTTGGKAPRKQLATKATRKSALATGGVKKPHQYRPGTVTLHEIRRYQKSTELLIR KLPFQRLVREIAQDFKTGLRFQSTAVIALQEACEAYLVGLFKDTNLCAIHAKRVTIMPRD IQLARCIRGERA NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atggctcgcactaagcagaccaccggcggcaaggcgccgcgcaagcagctggccaccaag gcgacccgcaagagcgcgctggccaccggcggcgtgaagaagccgcaccaataccgcccc ggcacggtgaccctgcacgagatccgccgctaccagaagtccacggagctgctgatccgc aagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaagaccggcctgcgc ttccagagcacggcggtgatagcgctgcaggaggcatgcgaggcctacctggtggggctc ttcaaggacaccaacctgtgtgccatccacgccaagcgggttaccatcatgcccagggac atccagcttgcccgctgcatccgcggagagagggcttaa

DBGET integrated database retrieval system