Bubalus kerabau (carabao): 129647886 Help Entry 129647886         CDS       T11435                                  Symbol NPPC Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism bke  Bubalus kerabau (carabao) Pathway bke04022   cGMP-PKG signaling pathway bke04081   Hormone signaling bke04270   Vascular smooth muscle contraction bke05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bke00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     129647886 (NPPC)   09133 Signaling molecules and interaction    04081 Hormone signaling     129647886 (NPPC)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     129647886 (NPPC)  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     129647886 (NPPC)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bke04052]     129647886 (NPPC) Cytokines and neuropeptides [BR:bke04052]  Neuropeptides   Unclassified    129647886 (NPPC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  129647886 NCBI-ProteinID:  XP_055430791 LinkDB All DBs Position 3:complement(173674974..173679727) Genome browser AA seq 126 aa AA seqDB search MHLSQLLACALLLALLSLRPSEAKPGAPPKVPRTQSGEEVAEPQAAGGGQKKGDKTPGGG GANLKDDRSRLLRDLRVDTKSRAAWTRLLHEHPNARKFKGGNKKGLSKGCFGLKLDRIGS MSGLGC NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcccagctgctggcctgcgccctgctgctcgcgctactctcgctccggccc tccgaagccaagcccggggcgccgccaaaggtcccgcgaactcagtccggcgaggaggtg gccgagccccaggctgcgggcggcggtcagaagaaaggcgacaagactcccgggggcggc ggcgccaatctcaaggacgaccgatcgcgactgcttcgggacctgcgcgtggacaccaag tcccgggcggcgtggacccgcctcctgcacgagcaccccaacgcgcgcaaattcaaagga ggcaacaagaagggtttgtccaagggctgcttcggcctcaagctggacaggatcggctcc atgagcggcctgggatgttag

DBGET integrated database retrieval system