Bubalus kerabau (carabao): 129648980 Help Entry 129648980         CDS       T11435                                  Symbol RAB5C Name (RefSeq) ras-related protein Rab-5C   KO K07889   Ras-related protein Rab-5C Organism bke  Bubalus kerabau (carabao) Pathway bke04014   Ras signaling pathway bke04137   Mitophagy - animal bke04144   Endocytosis bke04145   Phagosome bke04148   Efferocytosis bke04962   Vasopressin-regulated water reabsorption bke05132   Salmonella infection bke05146   Amoebiasis bke05152   Tuberculosis Brite KEGG Orthology (KO) [BR:bke00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     129648980 (RAB5C)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     129648980 (RAB5C)    04145 Phagosome     129648980 (RAB5C)    04137 Mitophagy - animal     129648980 (RAB5C)    04148 Efferocytosis     129648980 (RAB5C)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     129648980 (RAB5C)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129648980 (RAB5C)    05152 Tuberculosis     129648980 (RAB5C)   09174 Infectious disease: parasitic    05146 Amoebiasis     129648980 (RAB5C)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bke04131]     129648980 (RAB5C)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bke04147]     129648980 (RAB5C)    04031 GTP-binding proteins [BR:bke04031]     129648980 (RAB5C) Membrane trafficking [BR:bke04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     129648980 (RAB5C)  Endosome - Lysosome transport     129648980 (RAB5C) Exosome [BR:bke04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129648980 (RAB5C)   Exosomal proteins of other body fluids (saliva and urine)    129648980 (RAB5C)   Exosomal proteins of colorectal cancer cells    129648980 (RAB5C)   Exosomal proteins of bladder cancer cells    129648980 (RAB5C) GTP-binding proteins [BR:bke04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     129648980 (RAB5C) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  129648980 NCBI-ProteinID:  XP_055431844 LinkDB All DBs Position 4:21955924..21977830 Genome browser AA seq 216 aa AA seqDB search MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ RQASPNIVIALAGNKADLASKRAVEFQEAQAYAEDNSLLFMETSAKTAMNVNEIFMAIAK KLPKNEPQNAAGAPGRNRGVDLQESNPASRGQCCSN NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atggcgggtcggggaggcgcagcgcgacccaacggaccagctgctgggaacaagatctgt cagtttaagctggtcctgctgggggagtccgcggtgggcaaatccagcctcgtcctccgc ttcgtcaagggtcagttccacgagtaccaggagagcacaattggagcggccttcctcaca cagaccgtctgcttggacgacacaacagtcaagtttgagatctgggacacagctggacag gagcggtatcacagcctggcccccatgtactatcggggggcccaggctgccatcgtggtc tacgacatcaccaacacagatacctttgcacgggccaagaactgggtgaaggaattacag aggcaggccagccccaacatcgtcatcgcgcttgcgggcaacaaggcggacctggccagc aagagagctgtggagttccaggaagcacaagcctatgcagaggacaacagtttgctgttc atggagacatcagcaaagactgcgatgaacgtgaatgaaattttcatggcaatagctaag aagcttcccaagaacgagccccagaatgcagctggtgccccgggccggaaccgaggcgtg gacctccaggagagcaaccccgccagccgcggccagtgctgcagcaactga

DBGET integrated database retrieval system