Bubalus kerabau (carabao): 129649714 Help Entry 129649714         CDS       T11435                                  Symbol RAB5B Name (RefSeq) ras-related protein Rab-5B   KO K07888   Ras-related protein Rab-5B Organism bke  Bubalus kerabau (carabao) Pathway bke04014   Ras signaling pathway bke04137   Mitophagy - animal bke04144   Endocytosis bke04145   Phagosome bke04148   Efferocytosis bke04962   Vasopressin-regulated water reabsorption bke05132   Salmonella infection bke05146   Amoebiasis bke05152   Tuberculosis Brite KEGG Orthology (KO) [BR:bke00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     129649714 (RAB5B)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     129649714 (RAB5B)    04145 Phagosome     129649714 (RAB5B)    04137 Mitophagy - animal     129649714 (RAB5B)    04148 Efferocytosis     129649714 (RAB5B)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     129649714 (RAB5B)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129649714 (RAB5B)    05152 Tuberculosis     129649714 (RAB5B)   09174 Infectious disease: parasitic    05146 Amoebiasis     129649714 (RAB5B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bke04131]     129649714 (RAB5B)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bke04147]     129649714 (RAB5B)    04031 GTP-binding proteins [BR:bke04031]     129649714 (RAB5B) Membrane trafficking [BR:bke04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     129649714 (RAB5B)  Endosome - Lysosome transport     129649714 (RAB5B) Exosome [BR:bke04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129649714 (RAB5B)   Exosomal proteins of other body fluids (saliva and urine)    129649714 (RAB5B)   Exosomal proteins of colorectal cancer cells    129649714 (RAB5B)   Exosomal proteins of melanoma cells    129649714 (RAB5B) GTP-binding proteins [BR:bke04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     129649714 (RAB5B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  129649714 NCBI-ProteinID:  XP_055433444 LinkDB All DBs Position 1:65139955..65155672 Genome browser AA seq 215 aa AA seqDB search MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK LPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgactagcagaagcacagccaggcccaatgggcagccccaggccagcaaaatatgccag ttcaaactggtcctgctgggtgaatctgcagtggggaaatctagcctggtattacgtttt gtcaaagggcagttccacgagtatcaggagagcaccattggagcggccttccttacccag tctgtttgtctagatgacacgacagtcaagtttgagatctgggacacagctgggcaggag cgataccatagcttggcccccatgtactacagaggtgcccaagctgccattgtggtttat gacattactaatcaggaaaccttcgcccgagcgaagacatgggtaaaagaactacagcga caggccagtcctagcatcgttattgccctggcagggaacaaagctgacctggccaacaag cgcatggtggagtatgaagaggcccaggcgtatgcagatgacaacagcttattgtttatg gagacttcagccaagacagctatgaacgtgaacgatctcttcctggcaatagctaagaag ttgccaaagagtgaaccccagaatctggggggtgcagcaggccgaagccggggtgtggat cttcacgagcagtcccagcagaacaagagccagtgttgtagcaactga

DBGET integrated database retrieval system