Bubalus kerabau (carabao): 129652253 Help Entry 129652253         CDS       T11435                                  Name (RefSeq) glutathione S-transferase P   KO K23790   glutathione S-transferase P [EC:2.5.1.18] Organism bke  Bubalus kerabau (carabao) Pathway bke00480   Glutathione metabolism bke00980   Metabolism of xenobiotics by cytochrome P450 bke00982   Drug metabolism - cytochrome P450 bke00983   Drug metabolism - other enzymes bke01100   Metabolic pathways bke01524   Platinum drug resistance bke05200   Pathways in cancer bke05204   Chemical carcinogenesis - DNA adducts bke05215   Prostate cancer bke05225   Hepatocellular carcinoma bke05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bke00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     129652253   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     129652253    00982 Drug metabolism - cytochrome P450     129652253    00983 Drug metabolism - other enzymes     129652253  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     129652253    05204 Chemical carcinogenesis - DNA adducts     129652253   09162 Cancer: specific types    05225 Hepatocellular carcinoma     129652253    05215 Prostate cancer     129652253   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     129652253   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     129652253  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:bke02000]     129652253 Enzymes [BR:bke01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      129652253 Transporters [BR:bke02000]  Other transporters   Pores ion channels [TC:1]    129652253 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_7 GST_C_2 GST_N_3 GST_N_2 AHC1_C Motif Other DBs NCBI-GeneID:  129652253 NCBI-ProteinID:  XP_055436629 LinkDB All DBs Position 5:complement(5649882..5652802) Genome browser AA seq 210 aa AA seqDB search MPPYTIVYFPVQGRCEAMRMLLADQDQSWKEEVVAMQSWLQGPLKASCLYGQLPKFQDGD LTLYQSNAILRHLGRTLGLYGKDQREAALVDMVNDGVEDLRCKYVSLIYTNYEAGKEDYV KALPQHLKPFETLLSQNKGGQAFIVGDQISFADYNLLDLLRIHQVLAPSCLDSFPLLSAY VARLNSRPKLKAFLASPEHMNRPINGNGKQ NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgccgccctacaccatcgtctacttcccggttcaagggcgctgcgaggccatgcgcatg ctgctggccgaccaggaccagagctggaaggaggaggtggtagccatgcaaagctggctg cagggcccactcaaggcctcctgcctgtacgggcagctccccaagttccaggacggagac ctcactctgtaccagtccaatgccatcctgcgacacctgggccgcaccctcgggctgtat gggaaggaccagcgggaggcggccctggtggacatggtgaatgacggtgtagaggacctt cgctgcaaatacgtctccctcatttacaccaactacgaggcgggcaaggaggactatgtg aaggcgctgccccagcacctgaagcctttcgagactctgctgtcccagaacaagggtggc caggccttcattgtgggcgaccagatctcctttgcggattacaacctgctggacctgctt cggattcaccaagtcctggcacccagctgtctggactccttccccctgctctcagcctac gtggcccgcctcaactcccggcccaagctcaaggccttcctggcctccccggagcacatg aaccggcccatcaacggcaatgggaaacagtga

DBGET integrated database retrieval system