Bubalus kerabau (carabao): 129652912 Help Entry 129652912         CDS       T11435                                  Name (RefSeq) histone H3.3A   KO K11253   histone H3 Organism bke  Bubalus kerabau (carabao) Pathway bke04613   Neutrophil extracellular trap formation bke05034   Alcoholism bke05202   Transcriptional misregulation in cancer bke05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bke00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     129652912  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     129652912   09163 Immune disease    05322 Systemic lupus erythematosus     129652912   09165 Substance dependence    05034 Alcoholism     129652912  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bke03036]     129652912   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bke04147]     129652912 Chromosome and associated proteins [BR:bke03036]  Eukaryotic type   Nucleosome assembly factors    Histones     129652912 Exosome [BR:bke04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129652912 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  129652912 NCBI-ProteinID:  XP_055437990 LinkDB All DBs Position 5:83717044..83725199 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccgcaaatcgaccggtggtaaagcaccgaggaagcaa ctcgctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctggtactgtggcactccgtgaaattagacgttatcagaagtccactgaa cttctgattcgcaaacttcccttccagcgtctggtgcgggaaattgctcaggacttcaaa acagatctgcgcttccagagtgcagctattggtgctttgcaggaggcaagtgaggcctat ctggttggcctttttgaagacaccaacctgtgtgctatccatgccaaacgtgtaacaatt atgccaaaagacatccagctagcacgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system