Bubalus kerabau (carabao): 129655379 Help Entry 129655379         CDS       T11435                                  Symbol JUN Name (RefSeq) transcription factor Jun   KO K04448   transcription factor AP-1 Organism bke  Bubalus kerabau (carabao) Pathway bke01522   Endocrine resistance bke04010   MAPK signaling pathway bke04012   ErbB signaling pathway bke04024   cAMP signaling pathway bke04137   Mitophagy - animal bke04210   Apoptosis bke04310   Wnt signaling pathway bke04380   Osteoclast differentiation bke04510   Focal adhesion bke04530   Tight junction bke04620   Toll-like receptor signaling pathway bke04621   NOD-like receptor signaling pathway bke04625   C-type lectin receptor signaling pathway bke04657   IL-17 signaling pathway bke04658   Th1 and Th2 cell differentiation bke04659   Th17 cell differentiation bke04660   T cell receptor signaling pathway bke04662   B cell receptor signaling pathway bke04668   TNF signaling pathway bke04722   Neurotrophin signaling pathway bke04912   GnRH signaling pathway bke04915   Estrogen signaling pathway bke04921   Oxytocin signaling pathway bke04926   Relaxin signaling pathway bke04932   Non-alcoholic fatty liver disease bke04933   AGE-RAGE signaling pathway in diabetic complications bke05030   Cocaine addiction bke05031   Amphetamine addiction bke05132   Salmonella infection bke05133   Pertussis bke05135   Yersinia infection bke05140   Leishmaniasis bke05142   Chagas disease bke05161   Hepatitis B bke05162   Measles bke05166   Human T-cell leukemia virus 1 infection bke05167   Kaposi sarcoma-associated herpesvirus infection bke05169   Epstein-Barr virus infection bke05170   Human immunodeficiency virus 1 infection bke05171   Coronavirus disease - COVID-19 bke05200   Pathways in cancer bke05203   Viral carcinogenesis bke05207   Chemical carcinogenesis - receptor activation bke05208   Chemical carcinogenesis - reactive oxygen species bke05210   Colorectal cancer bke05211   Renal cell carcinoma bke05224   Breast cancer bke05231   Choline metabolism in cancer bke05235   PD-L1 expression and PD-1 checkpoint pathway in cancer bke05321   Inflammatory bowel disease bke05323   Rheumatoid arthritis bke05417   Lipid and atherosclerosis bke05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bke00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     129655379 (JUN)    04012 ErbB signaling pathway     129655379 (JUN)    04310 Wnt signaling pathway     129655379 (JUN)    04668 TNF signaling pathway     129655379 (JUN)    04024 cAMP signaling pathway     129655379 (JUN)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     129655379 (JUN)   09143 Cell growth and death    04210 Apoptosis     129655379 (JUN)   09144 Cellular community - eukaryotes    04510 Focal adhesion     129655379 (JUN)    04530 Tight junction     129655379 (JUN)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     129655379 (JUN)    04621 NOD-like receptor signaling pathway     129655379 (JUN)    04625 C-type lectin receptor signaling pathway     129655379 (JUN)    04660 T cell receptor signaling pathway     129655379 (JUN)    04658 Th1 and Th2 cell differentiation     129655379 (JUN)    04659 Th17 cell differentiation     129655379 (JUN)    04657 IL-17 signaling pathway     129655379 (JUN)    04662 B cell receptor signaling pathway     129655379 (JUN)   09152 Endocrine system    04912 GnRH signaling pathway     129655379 (JUN)    04915 Estrogen signaling pathway     129655379 (JUN)    04921 Oxytocin signaling pathway     129655379 (JUN)    04926 Relaxin signaling pathway     129655379 (JUN)   09156 Nervous system    04722 Neurotrophin signaling pathway     129655379 (JUN)   09158 Development and regeneration    04380 Osteoclast differentiation     129655379 (JUN)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     129655379 (JUN)    05207 Chemical carcinogenesis - receptor activation     129655379 (JUN)    05208 Chemical carcinogenesis - reactive oxygen species     129655379 (JUN)    05203 Viral carcinogenesis     129655379 (JUN)    05231 Choline metabolism in cancer     129655379 (JUN)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     129655379 (JUN)   09162 Cancer: specific types    05210 Colorectal cancer     129655379 (JUN)    05211 Renal cell carcinoma     129655379 (JUN)    05224 Breast cancer     129655379 (JUN)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     129655379 (JUN)    05170 Human immunodeficiency virus 1 infection     129655379 (JUN)    05161 Hepatitis B     129655379 (JUN)    05171 Coronavirus disease - COVID-19     129655379 (JUN)    05162 Measles     129655379 (JUN)    05167 Kaposi sarcoma-associated herpesvirus infection     129655379 (JUN)    05169 Epstein-Barr virus infection     129655379 (JUN)   09171 Infectious disease: bacterial    05132 Salmonella infection     129655379 (JUN)    05135 Yersinia infection     129655379 (JUN)    05133 Pertussis     129655379 (JUN)   09174 Infectious disease: parasitic    05140 Leishmaniasis     129655379 (JUN)    05142 Chagas disease     129655379 (JUN)   09163 Immune disease    05323 Rheumatoid arthritis     129655379 (JUN)    05321 Inflammatory bowel disease     129655379 (JUN)   09165 Substance dependence    05030 Cocaine addiction     129655379 (JUN)    05031 Amphetamine addiction     129655379 (JUN)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129655379 (JUN)    05418 Fluid shear stress and atherosclerosis     129655379 (JUN)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     129655379 (JUN)    04933 AGE-RAGE signaling pathway in diabetic complications     129655379 (JUN)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     129655379 (JUN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:bke03000]     129655379 (JUN) Transcription factors [BR:bke03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     129655379 (JUN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Jun bZIP_1 bZIP_Maf bZIP_2 Rab11-FIP3 MIC19_MIC25 RIMB1_N ZapB PspA_IM30 Fib_alpha TFIIA ATG16 DUF3450 FlaC_arch Motif Other DBs NCBI-GeneID:  129655379 NCBI-ProteinID:  XP_055441679 LinkDB All DBs Position 6:87778795..87781777 Genome browser AA seq 335 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGLVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGS LSSGGGAPSYGAAGLAFPAQPQQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMP GETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAS TANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag tctgagagcggcgcctacggctacagtaaccccaagattctgaagcagagcatgaccctg aatctggccgacccggtgggcagcctgaagccgcacctccgggccaagaactccgacctc ctcacctctcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctaatc atacagtccagcaacgggcatatcaccaccacgccgacccccacccagttcctgtgcccc aagaacgtgacggacgagcaggagggattcgccgagggcttcgtgcgcgccctggccgaa ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccggtcagcggggcg ggcctggtggccccggcggtggcctcggtggcgggcggcagcggcagcggtggcttcagc gccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaaccccggctcg ctgagcagcggcggcggggcgccctcctatggcgcggctggcctggcctttcccgcgcag ccccagcagcagcagcagcaaccgccgcagccgccgcaccacctgccccagcagatcccc gtgcagcacccgcggctgcaggccctgaaggaggagccgcagacggtgcccgagatgccc ggggaaacgccgcccctgtcccccatcgacatggagtcccaggagcggatcaaggcggag aggaagcgcatgaggaaccgcatcgctgcctccaagtgccggaaaaggaagctggagagg atcgcgcggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtcc acggccaatatgctcagggaacaggtggcccagcttaaacagaaagtcatgaaccacgtt aacagcgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system