Bubalus kerabau (carabao): 129657274 Help Entry 129657274         CDS       T11435                                  Symbol CXCL8 Name (RefSeq) interleukin-8   KO K10030   interleukin 8 Organism bke  Bubalus kerabau (carabao) Pathway bke04060   Cytokine-cytokine receptor interaction bke04061   Viral protein interaction with cytokine and cytokine receptor bke04062   Chemokine signaling pathway bke04064   NF-kappa B signaling pathway bke04072   Phospholipase D signaling pathway bke04218   Cellular senescence bke04620   Toll-like receptor signaling pathway bke04621   NOD-like receptor signaling pathway bke04622   RIG-I-like receptor signaling pathway bke04657   IL-17 signaling pathway bke04932   Non-alcoholic fatty liver disease bke04933   AGE-RAGE signaling pathway in diabetic complications bke04936   Alcoholic liver disease bke05132   Salmonella infection bke05133   Pertussis bke05134   Legionellosis bke05135   Yersinia infection bke05142   Chagas disease bke05144   Malaria bke05146   Amoebiasis bke05161   Hepatitis B bke05163   Human cytomegalovirus infection bke05164   Influenza A bke05167   Kaposi sarcoma-associated herpesvirus infection bke05171   Coronavirus disease bke05200   Pathways in cancer bke05202   Transcriptional misregulation in cancer bke05219   Bladder cancer bke05323   Rheumatoid arthritis bke05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bke00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     129657274 (CXCL8)    04072 Phospholipase D signaling pathway     129657274 (CXCL8)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     129657274 (CXCL8)    04061 Viral protein interaction with cytokine and cytokine receptor     129657274 (CXCL8)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     129657274 (CXCL8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     129657274 (CXCL8)    04621 NOD-like receptor signaling pathway     129657274 (CXCL8)    04622 RIG-I-like receptor signaling pathway     129657274 (CXCL8)    04657 IL-17 signaling pathway     129657274 (CXCL8)    04062 Chemokine signaling pathway     129657274 (CXCL8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     129657274 (CXCL8)    05202 Transcriptional misregulation in cancer     129657274 (CXCL8)   09162 Cancer: specific types    05219 Bladder cancer     129657274 (CXCL8)   09172 Infectious disease: viral    05161 Hepatitis B     129657274 (CXCL8)    05171 Coronavirus disease     129657274 (CXCL8)    05164 Influenza A     129657274 (CXCL8)    05163 Human cytomegalovirus infection     129657274 (CXCL8)    05167 Kaposi sarcoma-associated herpesvirus infection     129657274 (CXCL8)   09171 Infectious disease: bacterial    05132 Salmonella infection     129657274 (CXCL8)    05135 Yersinia infection     129657274 (CXCL8)    05133 Pertussis     129657274 (CXCL8)    05134 Legionellosis     129657274 (CXCL8)   09174 Infectious disease: parasitic    05146 Amoebiasis     129657274 (CXCL8)    05144 Malaria     129657274 (CXCL8)    05142 Chagas disease     129657274 (CXCL8)   09163 Immune disease    05323 Rheumatoid arthritis     129657274 (CXCL8)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129657274 (CXCL8)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     129657274 (CXCL8)    04932 Non-alcoholic fatty liver disease     129657274 (CXCL8)    04933 AGE-RAGE signaling pathway in diabetic complications     129657274 (CXCL8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bke04052]     129657274 (CXCL8)    00536 Glycosaminoglycan binding proteins [BR:bke00536]     129657274 (CXCL8) Cytokines and neuropeptides [BR:bke04052]  Cytokines   Chemokines    129657274 (CXCL8) Glycosaminoglycan binding proteins [BR:bke00536]  Heparan sulfate / Heparin   Chemokines    129657274 (CXCL8) SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 DUF6355 Motif Other DBs NCBI-GeneID:  129657274 NCBI-ProteinID:  XP_055443464 LinkDB All DBs Position 7 Genome browser AA seq 101 aa AA seqDB search MTSKLAVALLAAFLLSAALCEAAVLSRMSTELRCQCIKTHSTPFHPKFIKELRVIESGPH CENSEIIVKLTNGKEVCLNPKEKWVQKVVQVFVKRAEKQDP NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgacttccaagctggctgttgctctcttggcagctttcctgctctctgcagctctgtgt gaagctgcagttctgtcaaggatgagtacagaacttcgatgccaatgcataaaaacacat tccacacctttccaccccaaatttatcaaagaattgagagttatcgagagtgggccacac tgtgaaaattcagaaatcattgttaagcttaccaatggaaaagaggtctgcttaaacccc aaggaaaagtgggtgcagaaggttgtgcaagtatttgtgaagagagctgagaagcaagat ccatga

DBGET integrated database retrieval system