Bubalus kerabau (carabao): 129658582 Help Entry 129658582         CDS       T11435                                  Symbol NPY Name (RefSeq) pro-neuropeptide Y   KO K05232   neuropeptide Y Organism bke  Bubalus kerabau (carabao) Pathway bke04024   cAMP signaling pathway bke04080   Neuroactive ligand-receptor interaction bke04920   Adipocytokine signaling pathway bke04923   Regulation of lipolysis in adipocytes bke05034   Alcoholism Brite KEGG Orthology (KO) [BR:bke00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     129658582 (NPY)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     129658582 (NPY)  09150 Organismal Systems   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     129658582 (NPY)    04920 Adipocytokine signaling pathway     129658582 (NPY)  09160 Human Diseases   09165 Substance dependence    05034 Alcoholism     129658582 (NPY)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bke04052]     129658582 (NPY) Cytokines and neuropeptides [BR:bke04052]  Neuropeptides   GPCR binding    129658582 (NPY) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_3 LURY1 Motif Other DBs NCBI-GeneID:  129658582 NCBI-ProteinID:  XP_055445460 LinkDB All DBs Position 8:complement(74856691..74863571) Genome browser AA seq 97 aa AA seqDB search MLGSKRMGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDLARYYSALRHYINLIT RQRYGKRSSPETLISDLLMRESTGNIPRTRLEDPSMW NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgctgggtagcaagcgaatgggcttgtctggactgaccctcgccctgtccctgctcgtg tgcctgggcgccctggccgaggcgtacccctccaagcctgacaaccccggcgaggacgct ccggcggaggacttggccagatactactcagcgctgcgacattacatcaatctcatcacc aggcagagatacgggaaacgatctagccccgagaccctgatttcagacctcttgatgaga gaaagcacgggaaacattcccagaactaggctggaagacccttctatgtggtga

DBGET integrated database retrieval system