Bubalus kerabau (carabao): 129659005 Help Entry 129659005         CDS       T11435                                  Name (RefSeq) histone H3.3A-like   KO K11253   histone H3 Organism bke  Bubalus kerabau (carabao) Pathway bke04613   Neutrophil extracellular trap formation bke05034   Alcoholism bke05202   Transcriptional misregulation in cancer bke05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bke00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     129659005  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     129659005   09163 Immune disease    05322 Systemic lupus erythematosus     129659005   09165 Substance dependence    05034 Alcoholism     129659005  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bke03036]     129659005   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bke04147]     129659005 Chromosome and associated proteins [BR:bke03036]  Eukaryotic type   Nucleosome assembly factors    Histones     129659005 Exosome [BR:bke04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129659005 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  129659005 NCBI-ProteinID:  XP_055445929 LinkDB All DBs Position 8:32855564..33102563 Genome browser AA seq 136 aa AA seqDB search MASTKQTARKLTSGKAPRKQLTTKAALKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQSLVREIAQDFKTDLCFQSAAIGALLEAREAYLGGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctagtacaaagcagactgcccgcaaattgaccagtggtaaagcaccgaggaagcaa ctcactacaaaagccgctctcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctggtactgtggcactccgtgaaattagacgttatcagaagtccactgaa cttctgattcgcaaacttcccttccagagtctggtgcgggaaatagctcaggacttcaaa acagatctgtgcttccagagtgcagctattggtgctttgctggaggcaagggaggcctat ctgggtggcctttttgaagacaccaacctgtgtgctatccatgccaaacgtgtaacaatt atgccaaaagacattcagctagcacgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system