KEGG   Cytobacillus kochii: CKF48_07590
Entry
CKF48_07590       CDS       T05194                                 
Name
(GenBank) bifunctional 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin subunit
  KO
K18087  biphenyl 2,3-dioxygenase ferredoxin component
Organism
bko  Cytobacillus kochii
Pathway
bko00621  Dioxin degradation
bko01100  Metabolic pathways
bko01120  Microbial metabolism in diverse environments
bko01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bko00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    CKF48_07590
SSDB
Motif
Pfam: Rieske Rieske_2 Chorein_N
Other DBs
NCBI-ProteinID: ASV67201
UniProt: A0A248TG88
LinkDB
Position
complement(1520816..1521175)
AA seq 119 aa
MKYTKVCTLSDLPDDEGLKVVEGDTAVAVFNVNGKVLATQDRCSHAKWSLSEGGYLDGDV
IVCSLHMGKFCAHTGAVKMAPPWKPLKKYPVKVEGEDVFVAFEDGYFEAEQSKSKVMDG
NT seq 360 nt   +upstreamnt  +downstreamnt
atgaaatatacaaaggtttgcaccttgtctgatttaccagatgatgagggattaaaagta
gtggaaggggatacggcagtagcagtgtttaatgtgaatggtaaagtacttgccacacag
gatcgctgttctcatgccaaatggtcactgtccgagggcggttatttagatggagatgtc
atcgtttgttcactgcatatggggaagttttgcgctcatacgggggcagtaaagatggct
ccaccttggaaacctttgaagaaatatccggtaaaggttgagggggaggatgtatttgtg
gcatttgaggacggttactttgaagcagaacaaagtaagagcaaagtaatggatggttga

DBGET integrated database retrieval system