Blautia sp. SC05B48: EYS05_01370 Help Entry EYS05_01370       CDS       T06243                                  Name (GenBank) hypothetical protein   KO K02784   phosphocarrier protein HPr Organism blab  Blautia sp. SC05B48 Pathway blab02060   Phosphotransferase system (PTS) Brite KEGG Orthology (KO) [BR:blab00001]  09130 Environmental Information Processing   09131 Membrane transport    02060 Phosphotransferase system (PTS)     EYS05_01370  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:blab02000]     EYS05_01370 Transporters [BR:blab02000]  Phosphotransferase system (PTS)   Enzyme I and HPr    Phosphocarrier protein HPr [TC:8.A.8]     EYS05_01370 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PTS-HPr Csa3_N Motif Other DBs NCBI-ProteinID:  QCU01074 UniProt:  A0A4P9E8T8 LinkDB All DBs Position complement(320748..320978) Genome browser AA seq 76 aa AA seqDB search MTVRKVQFESMDEVNRFLDVTEHFPFAVDLKRGSRTVNGKSILGVASIGLGREMDFCAHV PELAPEITSSLGFCMR NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgacagtaagaaaagtacagtttgagagcatggatgaagtgaaccgttttcttgatgtg acggagcattttccgtttgcagtggatctgaaaaggggaagcaggacagtaaatggcaaa tccattcttggagttgcatctattggccttggcagagagatggacttttgtgcacatgtg ccggagcttgcgccggagatcacatccagtcttggtttttgcatgaggtag

DBGET integrated database retrieval system