KEGG   Bremia lactucae (lettuce downy mildew): 94344823
Entry
94344823          CDS       T10371                                 
Symbol
CCR75_001047
Name
(RefSeq) hypothetical protein
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
blac  Bremia lactucae (lettuce downy mildew)
Pathway
blac00190  Oxidative phosphorylation
blac01100  Metabolic pathways
blac04148  Efferocytosis
Module
blac_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:blac00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    94344823 (CCR75_001047)
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    94344823 (CCR75_001047)
Enzymes [BR:blac01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     94344823 (CCR75_001047)
SSDB
Motif
Pfam: UCR_TM Rieske
Other DBs
NCBI-GeneID: 94344823
NCBI-ProteinID: XP_067821099
UniProt: A0A976FR59
LinkDB
Position
LG5:complement(3447055..3448837)
AA seq 215 aa
MLKRLNSSVPPRCVQALQGRAAMSSKAVVDTYESPDHYFESDRIDAGDPSKRAFTYFMLG
GARVAYATAARLAVVKFVGSMSASADVLALATAEFDLSNISEGSTVTVKWRGKPIFIKHR
TPKEIDISNQVDVKNLRDPETDAVRVQKPEWLVVLGVCTHLGCVPTSDSGEYGGWFCPCH
GSHYDLSGRIRKGPAPLNLEIPPYQFLEENKILLG
NT seq 648 nt   +upstreamnt  +downstreamnt
atgctgaaacgactaaattctagtgtacccccgcgctgcgtgcaggccctacagggtcgc
gccgccatgagctccaaggccgtcgtggacacgtatgagtcgcccgatcactactttgaa
tcggaccggattgatgccggagaccctagcaagcgtgcctttacttacttcatgctaggg
ggtgctcgtgtggcgtacgcgaccgcagcgcgtcttgcggtcgtcaagtttgtgggcagc
atgagcgcatcggcggatgtgttggcgctcgcgacagcagaattcgatctgagcaatatc
agtgagggatcgaccgtcacggtaaagtggcgtgggaaaccgatctttatcaagcatcgg
acacccaaggagattgatatttcaaaccaagtggacgtcaagaacttacgcgaccccgag
accgacgctgtccgtgtccaaaaacccgagtggcttgtggtgcttggcgtatgtactcac
ttgggctgcgtgcccacgtctgactctggggagtacggcggctggttctgcccttgccac
ggttcgcattacgacctctcaggccgcatccgtaaaggcccagccccgctaaatttggag
attcccccgtatcagtttttggaggaaaacaagattcttctggggtaa

DBGET integrated database retrieval system