Blastomonas sp. RAC04: BSY18_299 Help Entry BSY18_299         CDS       T04450                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism blas  Blastomonas sp. RAC04 Pathway blas01100   Metabolic pathways blas01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:blas00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BSY18_299 (acpP)    00074 Mycolic acid biosynthesis     BSY18_299 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BSY18_299 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L12_N Ribosomal_L50 DUF1493 DUF5783 Motif Other DBs NCBI-ProteinID:  AOG01137 UniProt:  A0A1B3N707 LinkDB All DBs Position 296463..296699 Genome browser AA seq 78 aa AA seqDB search MSETGDRVKKIVIEHLGVEAEKVTEDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKISTVNDAIEYIDSHKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgagactggggaccgcgttaaaaagatcgtgatcgagcatctcggcgttgaagca gagaaggtcaccgaggacgcaagcttcatcgacgatctgggcgctgacagcctcgacatc gtcgaactggtgatggctttcgaggaagagttcggagttgaaattcccgacgacgccgcc gagaagatcagcaccgtcaacgatgccatcgaatatatcgacagccacaagggctga

DBGET integrated database retrieval system