Burkholderia latens: WK25_02355 Help Entry WK25_02355        CDS       T04819                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism blat  Burkholderia latens Brite KEGG Orthology (KO) [BR:blat00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:blat03032]     WK25_02355    03036 Chromosome and associated proteins [BR:blat03036]     WK25_02355    03400 DNA repair and recombination proteins [BR:blat03400]     WK25_02355 DNA replication proteins [BR:blat03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     WK25_02355 Chromosome and associated proteins [BR:blat03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     WK25_02355 DNA repair and recombination proteins [BR:blat03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       WK25_02355 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF937 DUF2267 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  AOK03402 UniProt:  A0A1B4NNX2 LinkDB All DBs Position 1:498771..499049 Genome browser AA seq 92 aa AA seqDB search MNKQELIDAVAAQTGASKAQTGETLDTLLEVIKKAVSKGDAVQLIGFGSFGSGKRAARTG RNPKTGETIKIPAAKTVKFTAGKAFKDAVNKR NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaggaactgatcgacgccgtcgccgcccaaacgggcgccagcaaggctcaa accggcgaaacgctggacacgctgctcgaagtaatcaagaaagccgtgtcgaagggtgat gcggttcagctgatcggcttcggcagcttcggttcgggcaagcgcgcagcacgtacgggc cgcaacccgaagaccggcgaaaccatcaagatcccggcagccaagacggtcaagttcacg gctggcaaggcgttcaaggacgccgtcaacaagcgttaa

DBGET integrated database retrieval system