KEGG   Bacillus licheniformis DSM 13 = ATCC 14580: BLi01218
Entry
BLi01218          CDS       T00200                                 
Symbol
med
Name
(GenBank) transcriptional activator protein Med
  KO
K05519  transcriptional activator of comK gene
Organism
bld  Bacillus licheniformis DSM 13 = ATCC 14580
Brite
KEGG Orthology (KO) [BR:bld00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bld03000]
    BLi01218 (med)
Transcription factors [BR:bld03000]
 Prokaryotic type
  Other transcription factors
   Others
    BLi01218 (med)
SSDB
Motif
Pfam: Bmp Peripla_BP_4 LPAM_2 PPR_2
Other DBs
NCBI-ProteinID: AAU40126
LinkDB
Position
1229135..1230088
AA seq 317 aa
MVYRLVAIFFILLALSGCGQSPLKGKIEKVGLLVPDTINDQVWGTKGYKGLLRIQSVYNV
DVYYKEGIDNDAAIKMAVEDFHKKGVNLIYGHGSEYEKAFNEICKDYPDIHFVLMNSKAD
HQNVTSISLEGEAMGFFGGMTAAHQSKTKKIGVLATYKWQPEVEGFSEGAKYLDPDIEVM
TEYVGQWDDSENAVKLYEKMKKAGADVVYPAGDGYNVPVIEQIKKDGLYAIGYVSDQSEL
GENVVLTSTIQHVDDAYELTADEFNKGTLKGGKRSFDIQDGVIEMGEFSPVVDQSFQEKM
NRLIDEYKKTNKLPNEH
NT seq 954 nt   +upstreamnt  +downstreamnt
atggtgtacaggcttgtcgcgatttttttcattctcctggcgctaagcggctgcggacaa
tcgccgctgaaagggaaaattgaaaaagtcggtttgcttgtccctgatacgataaatgac
caagtatggggaaccaaaggatataaaggattattaagaatacaatccgtctacaatgtc
gacgtctattataaagagggaatcgataatgacgctgccattaaaatggctgtagaagat
tttcacaaaaaaggcgtcaacctcatctacgggcacggaagcgaatatgaaaaagccttt
aatgagatatgcaaagattatcctgatattcattttgttttaatgaactcgaaagccgac
caccaaaatgtgacaagcatatcgcttgaaggagaagcgatggggttcttcggcggaatg
acggcggcccatcagtcaaaaacaaagaaaatcggcgtgctcgcaacgtataaatggcag
cctgaagtagaaggattttccgaaggggctaaatacctcgatccggacattgaggtgatg
acagaatatgtcggccagtgggacgacagcgaaaatgccgtcaaactgtatgaaaaaatg
aagaaggcaggcgcggatgttgtgtatccggccggagacgggtataatgtccctgtcatt
gaacaaatcaaaaaggacgggctgtacgctatcggctatgtaagcgaccagtcggaattg
ggtgagaatgtcgttttgacaagcactatacagcatgtagatgacgcttatgaactcacc
gccgacgagtttaataaaggaacgcttaaaggcggcaagcgctcatttgacattcaagac
ggcgtcatcgaaatgggagaattcagccctgttgtcgatcagtcatttcaagaaaagatg
aatcggctgattgacgaatacaaaaaaacaaacaaactgccaaacgaacattga

DBGET integrated database retrieval system