Shouchella lehensis: BleG1_0788 Help Entry BleG1_0788        CDS       T03204                                  Name (GenBank) sporulation inhibitor   KO K06371   developmental checkpoint coupling sporulation initiation to replication initiation Organism ble  Shouchella lehensis Brite KEGG Orthology (KO) [BR:ble00001]  09190 Not Included in Pathway or Brite   09193 Unclassified: signaling and cellular processes    99978 Cell growth     BleG1_0788 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sda SMN_G2-BD Motif Other DBs NCBI-ProteinID:  AIC93396 UniProt:  A0A060LPZ5 LinkDB All DBs Position complement(791699..791851) Genome browser AA seq 50 aa AA seqDB search MLQQLSDDLLLEAYDRAIQHCLNADFISIIKQELRRRGLLKHIHMKKDRS NT seq 153 nt NT seq  +upstreamnt  +downstreamnt atgttacagcaactatccgatgatcttcttctagaagcatatgatcgtgcgatccaacat tgtttgaatgctgactttatttccattattaaacaagaacttcggcgtcgaggactcctg aaacatatacatatgaaaaaagatcgttcttag

DBGET integrated database retrieval system