Shouchella lehensis: BleG1_1613 Help Entry BleG1_1613        CDS       T03204                                  Name (GenBank) acyl carrier protein   KO K24111   aryl carrier protein AsbD Organism ble  Shouchella lehensis Pathway ble00975   Biosynthesis of various siderophores ble01100   Metabolic pathways ble01110   Biosynthesis of secondary metabolites Module ble_M01060   Petrobactin biosynthesis, spermidine => petrobactin Brite KEGG Orthology (KO) [BR:ble00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00975 Biosynthesis of various siderophores     BleG1_1613  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ble01008]     BleG1_1613 Polyketide biosynthesis proteins [BR:ble01008]  Nonribosomal peptide synthetase (NRPS)   Nonlinear NRPS    Petrobacin synthetase     BleG1_1613 SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AIC94191 UniProt:  A0A060LSF7 LinkDB All DBs Position 1553922..1554191 Genome browser AA seq 89 aa AA seqDB search MTYEHAVNILYTIMKEDLALQTMDAFHPHARLNEELAIDSVMILHILLELETKYEIAIPD ESIDPAIFETVDRLAQFIQRQEKTTVTYD NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgacgtatgaacatgctgtaaacattctttacacaattatgaaagaagatctagcttta caaacaatggacgcctttcatccccatgcaaggctaaatgaagagttagctattgattca gttatgatcttgcacatcttgctagaactcgaaacaaaatatgagattgcgatcccggac gagtctattgatccggccatatttgagaccgttgatcgcttagctcagtttattcagcgt caagaaaagacaaccgttacctatgattaa

DBGET integrated database retrieval system