Bifidobacterium longum subsp. longum F8: BIL_13430
Help
Entry
BIL_13430 CDS
T02580
Name
(GenBank) transcriptional regulator, LysR family
Organism
blg
Bifidobacterium longum subsp. longum F8
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
LysR_substrate
HTH_1
HTH_20
HTH_8
MarR_2
DUF3287
HTH_30
Motif
Other DBs
NCBI-ProteinID:
CBK70828
LinkDB
All DBs
Position
1566333..1567298
Genome browser
AA seq
321 aa
AA seq
DB search
MNFLGIEYFAAVASEHSFSKAAKRLGITQQTLSANIAALERELGCTLFVRHVPLELTYAG
TVFARYAQRFRRDRDALGQEMRDIAGDQAGVLRVGVAYTRSRAIMPPIVKAMQRDCPNII
VELIEGRNDQIQQWLANGDLDLAVADFAGKPAGIELMDFYNERMVLVLAQSLWMDLAATG
GAANGQVDAVRTAPDERAIAAGDLSSLEHCPFLLGSPQDIDGRIADLLFRRAGFEPKVTA
RSDNVLTLLELCHYGMGACLCPERFLPALLDGERLRTLRVLDCGPDTAYAIQFGVPATSY
RWSVIDDFIRCAREVTTGVSQ
NT seq
966 nt
NT seq
+upstream
nt +downstream
nt
atgaactttctcggcatcgaatacttcgccgccgtggcctcggaacatagcttcagcaag
gcggcgaaacggttggggatcacgcagcagacgctgagtgcgaacatcgccgccctagag
cgggagctcggatgcacgcttttcgtacgccatgtgccgctcgaattgacctatgccggc
acggtgttcgcgcgatatgcgcagcgattccgccgcgatcgcgatgcacttggccaagaa
atgcgcgacatcgccggcgatcaggccggcgtgctgcgcgtgggtgttgcctacacgcgt
agccgggcgatcatgccgccgattgtgaaggcgatgcaacgtgactgcccgaatatcatc
gttgaactcattgagggccgcaacgatcagattcaacaatggctggcgaacggcgatctt
gatctggcggtggcggacttcgccgggaaaccggccggcatcgaacttatggatttctat
aacgagcgcatggtgctggtcctcgcacaatcactgtggatggatttggccgctaccggt
ggcgcggcgaatggccaagtcgatgccgtcagaaccgcgccggacgagcgcgccattgcc
gcaggtgacctttcctcactggagcattgcccgtttctcctaggcagcccacaagatatt
gacggacgcattgccgatctgctgttccgccgtgccggttttgagccgaaagtcacagcc
cgttcggataacgtactgactctgctggaactgtgccattacggcatgggtgcctgccta
tgcccggagcggttcctgccagcgctgcttgacggcgaacggttgcgtactttgcgcgtg
ctggattgcggcccggataccgcatatgccattcagttcggcgttccggccacatcgtat
cggtggagcgtcattgatgatttcattcgttgcgcccgcgaagtcaccaccggcgtgtcg
caatag
DBGET
integrated database retrieval system