Blautia liquoris: INP51_10080 Help Entry INP51_10080       CDS       T07726                                  Name (GenBank) ferredoxin family protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism bliq  Blautia liquoris Pathway bliq00020   Citrate cycle (TCA cycle) bliq00720   Other carbon fixation pathways bliq01100   Metabolic pathways bliq01110   Biosynthesis of secondary metabolites bliq01120   Microbial metabolism in diverse environments bliq01200   Carbon metabolism bliq01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:bliq00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     INP51_10080   09102 Energy metabolism    00720 Other carbon fixation pathways     INP51_10080 Enzymes [BR:bliq01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      INP51_10080 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_10 Fer4_9 Fer4_2 Fer4_16 Fer4_21 LdpA_Fe-S-bd Fer4_6 Fer4_13 Fer4_8 Fer4_4 Fer4_17 Fer4_3 Fer4_22 Fer4_18 Fer4_ETF_QO Fer4_15 Se_S_carrier Motif Other DBs NCBI-ProteinID:  QOV18364 UniProt:  A0A7M2REH4 LinkDB All DBs Position complement(2194369..2194599) Genome browser AA seq 76 aa AA seqDB search MPEVKVVSERCKSCGYCVKFCPKNVLEIGTKVNSKGYEYVTPKNIQNCIGCCICGRMCPE GALEIYKEEQGAKKNV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgcctgaagtaaaagtagtatcagaacgctgtaaaagctgcggctattgcgtgaaattc tgtcctaaaaatgttctggagatcggaacaaaagtgaattctaaggggtatgaatatgta actccaaagaatatacagaactgtatcggatgctgcatctgcggaagaatgtgtccggaa ggtgcattagaaatttataaagaagaacagggggccaaaaagaatgtctag

DBGET integrated database retrieval system