Brevibacillus laterosporus: BRLA_c020360 Help Entry BRLA_c020360      CDS       T03762                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism blr  Brevibacillus laterosporus Pathway blr00998   Biosynthesis of various antibiotics blr01100   Metabolic pathways blr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:blr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BRLA_c020360    00074 Mycolic acid biosynthesis     BRLA_c020360   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BRLA_c020360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PRD Motif Other DBs NCBI-ProteinID:  AIG26357 UniProt:  A0A075R1A7 LinkDB All DBs Position 2141663..2141938 Genome browser AA seq 91 aa AA seqDB search MGTTNSTDYGLVIKNDLAEIIKSHYGQEVDPASISNDLDIIKQYNLDSIVIMELLVTIEK RFDIQIEDDELSSELVRTIHTVVTYIQSKKR NT seq 276 nt NT seq  +upstreamnt  +downstreamnt gtgggaactacaaattcaacagactacggtctagtcattaaaaatgatctggcggagatt ataaaatcacattatggtcaggaagttgatcccgctagtatttcaaacgacctagatatt atcaaacaatataatttagattccattgttattatggaattgctagtaacgatcgaaaag cgatttgatattcaaatagaagatgatgagcttagttcagaattagtacggacaattcat acggtagtgacttatattcagtcgaaaaaaagataa

DBGET integrated database retrieval system