KEGG   Brevibacillus laterosporus: BRLA_c027440
Entry
BRLA_c027440      CDS       T03762                                 
Name
(GenBank) purine-binding protein precursor
  KO
K05519  transcriptional activator of comK gene
Organism
blr  Brevibacillus laterosporus
Brite
KEGG Orthology (KO) [BR:blr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:blr03000]
    BRLA_c027440
Transcription factors [BR:blr03000]
 Prokaryotic type
  Other transcription factors
   Others
    BRLA_c027440
SSDB
Motif
Pfam: Bmp Peripla_BP_4 Peripla_BP_6 mCpol
Other DBs
NCBI-ProteinID: AIG27063
UniProt: A0A075R782
LinkDB
Position
3121572..3122570
AA seq 332 aa
MTEQSKGFVYIIGALVIWLLLLLTFQFLLNMKQIQGFTRKNVAEHQIALLLEGPTFDQAW
NSAALQTMYKLQDKYHFDLEIVQEVDRHKIKAVASNLAESGYDLIMGHGIVFSEPFTEVA
AMYPHTRFVTLNGTASHPNQTVIQFDMEPAGYLIGKLATLMSKTKTVGFIVADMPNDRPL
AKGLERGVKETDPSAKALIRFIPDYNDTKAAVKAARNLMTEHKADVIYSAGDSINLQVIN
EVQKQNVLAIGYISDQRFLAPNHVISSLVQDVEQVYTTLIEQYLQKRLESGTVLYGLNEN
VNCLGPYGKMVPLSVQLEMNRTIENLKRANAH
NT seq 999 nt   +upstreamnt  +downstreamnt
gtgaccgaacaatccaagggtttcgtctacattattggagctttggtaatctggttactt
ttgctcctaacctttcagtttctattaaatatgaaacaaatccaagggttcacacgaaaa
aatgtagccgaacatcaaattgctttacttttagagggtcctactttcgatcaagcttgg
aatagtgcagccctgcagactatgtataagctacaggacaagtatcattttgatctagag
atcgttcaggaagtggatagacataaaattaaggcagtcgcatccaatctggcagagtca
ggatatgatttaatcatgggtcacggaatcgttttctctgaaccctttacagaggtagct
gccatgtatccacatacaaggtttgtcactcttaatggaacggccagtcatccaaatcaa
acagtcattcaatttgatatggaaccagccggttatcttattggcaagctggctaccctg
atgtccaaaacgaagactgtaggctttatcgttgcagatatgcctaatgataggcctctt
gcgaagggattagagcgtggagtgaaagaaacagacccttccgcaaaagctttaatcagg
tttattccagattacaatgatacaaaggccgccgtcaaagccgctcggaatttgatgact
gagcataaagctgatgtgatttactctgcaggtgatagtattaatttacaagtaatcaat
gaggtgcaaaaacaaaatgtccttgctattggatatattagtgaccagcgtttcttagcg
ccgaaccatgtaatttctagcctcgtgcaagacgtagagcaagtgtatacgaccttaatt
gaacaatatcttcaaaaaagacttgaaagtggcaccgtattgtatgggcttaatgagaat
gtaaattgcttggggccttatgggaagatggttcctctttccgtccaactagaaatgaat
cgtaccatagaaaatctaaaacgagccaatgcccattga

DBGET integrated database retrieval system