Blautia luti: Blut17040_20210
Help
Entry
Blut17040_20210 CDS
T09496
Name
(GenBank) ABC transporter permease
KO
K02034
peptide/nickel transport system permease protein
Organism
blui
Blautia luti
Pathway
blui02024
Quorum sensing
Brite
KEGG Orthology (KO) [BR:
blui00001
]
09140 Cellular Processes
09145 Cellular community - prokaryotes
02024 Quorum sensing
Blut17040_20210
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
blui02000
]
Blut17040_20210
Transporters [BR:
blui02000
]
ABC transporters, prokaryotic type
Peptide and nickel transporters
Peptides/nickel transporter
Blut17040_20210
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
BPD_transp_1
OppC_N
DUF6132
DUF624
Motif
Other DBs
NCBI-ProteinID:
BEI60992
LinkDB
All DBs
Position
complement(2219302..2220162)
Genome browser
AA seq
286 aa
AA seq
DB search
MNRRKKHAQLSEFWRRFRKNKAAVLGLVLLVLIIGMAVFADLIVPYSKCIEQVGADRLQG
PSLKHFFGTDELGRDLFARIVHGSRYSLLIGLATSLMALVVGAILGASAGYFGGVVDNVI
SRIMDVFMCVPPILLSLAVVAALGTNLRNLIIAITVSCIPGNVRLIRSVVLTTAEQDYVE
AAKSYGTSNARIIFRYVLPNAMGPIIVNTTMSISDMMLSAAGLSFIGMGIQPPSPEWGAL
LSNAQTYLFSAPYMLLFPGMFILLSSLAFNLVGDGLTDALDPKLKD
NT seq
861 nt
NT seq
+upstream
nt +downstream
nt
atgaatagaagaaaaaaacatgcccagctttcagaattctggcgtcgtttccgcaagaac
aaagcagctgttctgggactggttctgctggtactgatcattggaatggcagtatttgca
gacctgatcgtaccttatagcaaatgtattgaacaggttggtgccgaccgtcttcaggga
ccgagcctgaaacatttctttggaacagacgaactgggacgagacctctttgcacgaatc
gttcacggttccagatattctctgctgatcggacttgcgaccagtctgatggcactggta
gtcggtgcaatccttggtgcaagtgccggatatttcggtggagttgttgataatgtgatc
agccgtatcatggacgtattcatgtgcgtgcctccaatcctcctttccctggcagtggta
gcagccctgggaacaaacttacgaaatctgatcattgcgattaccgtttcctgtattccg
ggaaatgtccgactgatccgttcggtagtcctgacaaccgcagagcaggattacgtagag
gcagcgaaatcctacggaacctccaatgcgagaattatttttcgttatgtactgccgaat
gcaatgggaccgatcattgtaaatacaaccatgagtatttcagatatgatgctctctgca
gcaggactgagctttatcggaatgggtatccagccgccgtcaccggaatggggggcactg
ctttctaatgcccagacttatctgttttctgcaccgtatatgctgcttttcccgggtatg
tttatcctgttatcctcccttgcttttaacctggtaggtgacggactgacagatgccctg
gatccgaaactgaaagactaa
DBGET
integrated database retrieval system