Bradyrhizobium lupini: AB3L03_02545 Help Entry AB3L03_02545      CDS       T11005                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism blup  Bradyrhizobium lupini Pathway blup01100   Metabolic pathways blup01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:blup00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AB3L03_02545    00074 Mycolic acid biosynthesis     AB3L03_02545   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AB3L03_02545 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  XDI31992 LinkDB All DBs Position complement(471969..472208) Genome browser AA seq 79 aa AA seqDB search MSEIGERVKKIVVEHLGVEPEKVVDAASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAA ETILTVGDATKFLEKNAKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtgagattggcgagcgggttaagaagatcgtggtcgaacaccttggtgttgaaccc gagaaggttgtcgacgctgcgagcttcatcgacgacctcggcgccgacagtctggacacc gtcgagctggtgatggcgttcgaagaggaattcggctgcgagattccggacgatgccgcg gaaacgattctcaccgtcggcgacgccaccaagtttctcgagaagaacgcgaagagctaa

DBGET integrated database retrieval system