KEGG   Bifidobacterium animalis subsp. lactis V9: BalV_1362
Entry
BalV_1362         CDS       T01843                                 
Name
(GenBank) ABC-type multidrug transport system ATPase and permease component
  KO
K16014  ATP-binding cassette, subfamily C, bacterial CydCD
Organism
blv  Bifidobacterium animalis subsp. lactis V9
Pathway
blv02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:blv00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BalV_1362
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:blv02000]
    BalV_1362
Transporters [BR:blv02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    BalV_1362
SSDB
Motif
Pfam: ABC_tran ABC_membrane SMC_N AAA_21 AAA_16 AAA_29 AAA_22 RsgA_GTPase NACHT nSTAND3 AAA_23 AAA DUF87 AAA_25 AAA_30 nSTAND1 DUF2486
Other DBs
NCBI-ProteinID: ADG33950
LinkDB
Position
complement(1650511..1654092)
AA seq 1193 aa
MFDKRLFPLAPGVRGLIVAKVVCLWVGLLADIALSVTAVSLMGAVLGRNTAYTFTVVSLG
WYALAFAVIAFIRFLAHYLGSRFGTEAAERVKLGLRNALYRKLLVLGPSYRQQASTASIV
QLAGEGVDQVQSFYEKFVPQLFYAVLAPLTLFAVLAPINMPTAVVLLVCAPLIVIIVGMV
AMRASRVFKKYWGKYTDMGSAFLDNLQGLETLKTFDADESAARKMHEEAENFRVMTMRVL
QIQLRSLTAMDVVAYGGAAAGIGVAIWQLTHSGVTMFRTTFAPLDMFAGPQLGSPGMLLI
VLLSASFFLPLRQLGSFFHVAMNGMTSSKKIFALLDAPAPHHGEQTLPAGPISVHAHNLG
FFYGDDEADAQPALRKVSLDIPAHSLTAIVGESGSGKSTLAALIAGELEGYSGSLAFEVD
GESVEVADLSESALMAAVSFVGARSHLFVGTLRDNLIMANPQATDEQLHHALRLAHIDDF
VREQPAGLGMPIDPANLSGGQRQRIAVARALLHEAPIMIFDEATSSVDAESEALIMQTIH
ELAQSKTVIVVTHRLADTVDADMIAVFDHGSCVETGDSSTLMAADGRYARMFHAQATVEQ
VHRRTEGGGIRYAHTQNEVGGDMPKRVAESAGKRNAALSGIDMAADDAMTTVQVIRRLLA
QVGSLRPLMVLACCFGVLGHLAATFMPVFGIMAACAAFGHPVWGLSVGWAVTLMVVCAAI
RGIMAYCEQYMNHNLAFRLLALFRERAFDALRRLAPAALANRGNGDMISLITTDVELLEI
FFAHTISPTIIALSTTVLYTVALLFLSPWFALLLVIAHLLLGVLMPRLFAAALRGVGSKL
RKDSAALDDQVLDDMHGLDQIIRFDCGDDRLKRIDAWSRSLWRQRTRLSARNGAFSGYDS
MIVIVVTAVAALLALTLSLGNTSAAANIAAFVLVVSSFGPTLALSALPANLTQTFASARR
LFSVLDAEPAVEERGTEQCAYDGMSLDGVTFGYGDGAPVLRDVTMDIPLSGILGIQGPSG
RGKSTLLKLLMRYWDPQQGTVSMSGHALPAIDAHTRRRLQTMMSQETYLFDDTIAGNLRI
AKPEASDDELHRALEQASIAALVDDLPEGMETRVGELGDRLSEGERQRLGLARMFLRDAS
LYLFDEPTSRLDSLNEAYILQSINALVEERDAAVVLVSHRASTMRIADGIHKA
NT seq 3582 nt   +upstreamnt  +downstreamnt
atgttcgataagcgcctgtttcccctcgctcccggcgtgcgtgggctcatcgtggcgaaa
gtggtgtgcctgtgggtcggtctgctcgccgacattgcgttgtctgtcactgctgtgtcg
ttgatgggcgcagtgctgggccgcaataccgcatatacgttcactgtggtgtcgctgggg
tggtacgcgctcgcattcgcagtcatcgcgttcatacgattccttgcccactatctcggt
tcacggttcggcaccgaggcggccgagcgtgtcaaactcggcttgcgcaatgcgttgtat
cgcaagctgctcgtgctcggcccgtcgtatcgtcagcaggcgagcacggcgagcattgtg
cagctcgccggtgaaggcgtggaccaggtgcagagtttctacgagaagttcgtgccgcag
ctgttctacgctgtactcgccccgcttacgttgtttgccgtgcttgcgccgatcaatatg
cccacagccgtcgtgctgctcgtttgtgcgccgctcatcgtgatcatcgtcggcatggtc
gccatgcgcgcgtcccgcgtgttcaagaaatactggggcaagtacaccgatatgggctcc
gcgttcctcgacaatctgcaggggctggagacgctgaagaccttcgatgccgacgagtcg
gccgccaggaagatgcacgaggaggccgagaatttccgtgtgatgacgatgcgcgtgctg
cagatccagctacgctcgctcaccgccatggatgtcgttgcctatggcggtgcggcggct
ggcatcggcgtggcaatctggcagctcacgcatagtggtgtcacgatgttccgcaccacc
ttcgcgccactggatatgttcgccggaccgcagctcggctcgccgggcatgttgctcatc
gtgctgctctccgcatcgttcttcctgccgttgcgccagctcggttcattcttccacgtg
gcgatgaacggcatgacttccagcaagaagatcttcgcgttgctcgacgcaccagctccg
catcatggtgagcagacgctccccgccgggccgatttccgtgcatgcacataatctgggc
ttcttctatggagacgacgaagcagatgcccaaccggcattgcgcaaggtctcgcttgac
attccggcacattcgctgaccgccattgtcggtgaatccggatccggcaagtccacgctc
gccgcgctcatcgccggcgaactcgaagggtacagtggctcattggccttcgaagtggat
ggtgaatccgtcgaagtggctgatctatccgaatccgcactgatggctgccgtctccttc
gtcggtgcgcgcagccatctgttcgtggggacgttgcgcgacaatctgatcatggcgaat
ccgcaagccaccgacgagcaactgcatcacgcgttgcgactcgcgcatatcgatgatttc
gtacgcgagcagccggcagggcttggtatgccaatcgatccggcgaatctctccggcggc
caacgtcagcgcatcgctgtggcacgcgcgctgctgcatgaggcgccgatcatgattttc
gatgaggcgaccagcagtgtcgacgccgaatccgaggcgctcatcatgcagacaatccac
gagctcgcgcagtcgaagacggtgatcgtcgtcacacatagactcgccgacacggtggac
gcggatatgattgccgtcttcgaccacggcagctgcgtggaaaccggcgactctagcaca
ttgatggctgcggatggccgctatgcgcgcatgttccacgcccaggccaccgtcgaacaa
gtgcatcggcgtacggaaggcggcggcatacgctacgcgcacacgcagaacgaagtgggc
ggcgacatgccgaagcgtgttgcggaatctgctgggaaacggaacgctgcgctttccggc
attgatatggctgccgacgatgcgatgacgaccgtgcaggtgattcgccgtctgctcgca
caggtgggttcattgcgtccgttgatggtgttggcatgctgctttggtgtgctcggccac
ttggcggccacgttcatgccggtgtttggcatcatggcggcgtgcgcggcgtttggtcac
ccggtgtggggtttgtctgtcggctgggccgtgaccctgatggtggtgtgtgcggcgatc
cgcggcatcatggcctactgcgagcagtacatgaaccacaatctggcgttccgtctgctc
gcattgttccgtgaacgtgcgttcgacgcattgcgcagactcgctccggctgcgcttgcg
aaccgtggcaacggcgatatgatctcgctgatcaccaccgacgtggaattgcttgagatc
ttcttcgcccacacgatctcgccgacgattatcgcgctctcgacgaccgtgctttatacg
gtggcgttgctgttcctgagcccctggtttgcattgttgctggtgatcgcgcatctgctg
ctcggcgtgctgatgccgcgtctgttcgctgccgcgctccgtggtgtgggttcaaaactg
cgcaaggacagcgctgcgcttgacgatcaagtgctcgatgacatgcatgggcttgaccag
atcattcgctttgattgtggtgacgaccggctgaagcggattgatgcgtggtcgaggtca
ttgtggcgccagcgcacgagattgagtgcgcggaacggtgcattcagcggctacgacagc
atgatcgtgattgtggtgacggccgtggcggcattgctggcgttgacattgagccttggc
aacacgagtgctgctgcaaatatcgccgcattcgtgctcgtggtgagttccttcggcccc
acgctcgcactgagcgcgttgccggcgaatctgacgcagaccttcgcctccgcacgcaga
ctgttctcggtgctcgacgccgaacctgcagtggaagagcggggaaccgagcaatgcgca
tacgacggcatgtcgttggacggggtgacgttcggctatggtgacggtgcgccggtgttg
cgtgatgtcacgatggatatcccgctctccgggatcctcggtattcagggaccgtctgga
cgtggcaagtccacattgctcaagttgctgatgcgctactgggacccacaacaaggcacc
gtgtcaatgtccgggcatgctttgcctgccatcgatgcgcatacgcgtaggcggttgcag
acgatgatgagccaggagacgtacctgttcgatgacacgattgccggcaacctgcgcatc
gccaaaccggaggcgagcgatgacgaattgcacagggctctggagcaggcatccatcgct
gctttggtggatgatcttcctgagggcatggagacgcgtgtgggcgaactcggtgatcgg
ctttcggaaggtgaacgacagcgcctcggcctggcccgcatgttcctgcgcgatgcgagc
ctctacctgttcgacgagccgaccagtcgcctggattcactcaacgaggcctatatcctg
cagtcgatcaacgctctggtcgaagagcgtgatgcggctgttgtgcttgtttctcaccga
gcttcgacgatgcggatcgctgatggaattcataaagcatga

DBGET integrated database retrieval system