Burkholderia mallei ATCC 23344: BMA3206 Help Entry BMA3206           CDS       T00204                                  Symbol grx3 Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism bma  Burkholderia mallei ATCC 23344 Brite KEGG Orthology (KO) [BR:bma00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:bma03110]     BMA3206 (grx3) Chaperones and folding catalysts [BR:bma03110]  Protein folding catalysts   Protein disulfide isomerase    BMA3206 (grx3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like Thioredoxin_2 DSBA Thioredoxin_3 Pyridoxal_deC Motif Other DBs NCBI-ProteinID:  AAU50112 UniProt:  A0A0H2WKJ8 LinkDB All DBs Position 1:complement(3308771..3309031) Genome browser AA seq 86 aa AA seqDB search MNKVVMYSTQVCPYCMQAERLLKLRGVEHIEKVLIDKEPERRAEMMERTGRRTVPQIYIG DTHVGGYDDLSKLDREGGLKPLLEAA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt gtgaacaaagtggtcatgtacagcacgcaggtgtgcccgtattgcatgcaggccgagcgg ctcctcaagctgcgcggcgtcgagcacatcgagaaagtgctgatcgacaaggagccggag cgccgcgcggagatgatggagcgcaccggccgccgcaccgtgccgcagatctacatcggc gacacgcacgtcggcggttacgacgacctgtcgaagctcgaccgcgaaggcggcctgaag ccgcttctcgaagccgcctga

DBGET integrated database retrieval system