Burkholderia mallei ATCC 23344: BMAA0353
Help
Entry
BMAA0353 CDS
T00204
Symbol
oppC
Name
(GenBank) oligopeptide ABC transporter, permease protein
KO
K15582
oligopeptide transport system permease protein
Organism
bma
Burkholderia mallei ATCC 23344
Pathway
bma01501
beta-Lactam resistance
bma02010
ABC transporters
bma02024
Quorum sensing
Brite
KEGG Orthology (KO) [BR:
bma00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
BMAA0353 (oppC)
09140 Cellular Processes
09145 Cellular community - prokaryotes
02024 Quorum sensing
BMAA0353 (oppC)
09160 Human Diseases
09175 Drug resistance: antimicrobial
01501 beta-Lactam resistance
BMAA0353 (oppC)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
bma02000
]
BMAA0353 (oppC)
Transporters [BR:
bma02000
]
ABC transporters, prokaryotic type
Peptide and nickel transporters
Oligopeptide transporter
BMAA0353 (oppC)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
BPD_transp_1
OppC_N
Motif
Other DBs
NCBI-ProteinID:
AAY59160
UniProt:
A0A0H2XF15
LinkDB
All DBs
Position
2:340656..341558
Genome browser
AA seq
300 aa
AA seq
DB search
MTPVTSSIELPTAADAPPRSRTPLGLAARHFVRNRAALASLAALALIALMCFVGPLLLPN
DPAASDWSSISLAPTLANAHWFGTDELGRDLLVRTLIGGRVSLEVGLLGTFVSGLFGVAW
GAIAGFAGGRVDAAMMRVVDMMYAIPYLLIAILMMTLFGRSFILVVLTISAFSWLDMARV
VRGQTLSLRTREFVDAARAIGVTPAAIVRRHIVPNLLGVVVVYATVSVPAIVLTESVLSF
LGLGVQEPMTSWGVLIQDGAQKLEAMPWLLLAPAVMLCVTLYCVNFVGDGLRDALDPKDR
NT seq
903 nt
NT seq
+upstream
nt +downstream
nt
atgacgcctgttacctcttcgatcgagctgccgacggcggccgacgcgccgccgcgctcg
cgcacgccgctcgggcttgccgcgcggcacttcgtgcgcaaccgcgcggcgctcgcgagc
ctcgcggcgctcgcgctgatcgcgctcatgtgcttcgtcgggccgctgctcctgcccaac
gatccggccgcgagcgactggtcgtcgatcagtctcgcgccgacgctcgccaacgcgcat
tggttcggcaccgacgagctcggccgcgatctgctcgtgcgcacgctgatcggcgggcgc
gtgtcgctcgaagtcggcctgctcggcacgttcgtgtcggggctgttcggcgtcgcgtgg
ggcgcgatcgcgggcttcgccggcggccgcgtcgacgcggcgatgatgcgcgtcgtcgac
atgatgtatgcgattccgtatctgctgatcgcgatcctgatgatgacgctgttcgggcgt
tcgttcattctcgtcgtgctgacgatcagtgcgttctcttggctcgacatggcgcgcgtc
gtgcgcggccagacgctttcgctgcgcacgcgcgagttcgtcgatgcggcgcgcgcgatc
ggcgtcacgccggcggcgatcgtgcggcgccacatcgtgccgaatctgctcggcgtggtg
gtggtctacgcgaccgtcagcgtgccggcgatcgtgctgaccgaatcggtgctgtcgttt
ctcgggctcggcgtgcaggagccgatgacgagctggggcgtgctgatccaggacggcgcg
cagaagctcgaggcgatgccgtggctgctgctcgcgcccgccgtgatgctgtgcgtgacg
ctctactgcgtgaacttcgtcggcgacggcctgcgcgacgcactcgatccgaaggaccgc
tga
DBGET
integrated database retrieval system