Burkholderia mallei ATCC 23344: BMAA0720 Help Entry BMAA0720          CDS       T00204                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bma  Burkholderia mallei ATCC 23344 Brite KEGG Orthology (KO) [BR:bma00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bma03036]     BMAA0720    03400 DNA repair and recombination proteins [BR:bma03400]     BMAA0720 Chromosome and associated proteins [BR:bma03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BMAA0720 DNA repair and recombination proteins [BR:bma03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BMAA0720 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS DIP0205-like_N DUF6376 Motif Other DBs NCBI-ProteinID:  AAU46891 UniProt:  A0A0H2WED4 LinkDB All DBs Position 2:729895..730185 Genome browser AA seq 96 aa AA seqDB search MATYKELLAQLDDLKQQAKRARALELPDVLVGLRKKIVEYGLSQKDLFPPRLGRPKKADA LPKPRYRDPDTGATWTGRGRAPAWIAGQDRERFRID NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcaacatacaaggaattgcttgcccaattggatgatttgaagcagcaggcgaagcgc gcccgcgcgctcgagttgcccgacgtgctcgtcgggttgcgcaagaagatcgtcgaatac ggtctctcgcagaaagacctgtttccgcctcgcctcggacggccgaagaaagccgacgcg ctgccgaagccgcgctatcgcgatccggacacgggcgcgacatggacggggcgcggccgc gcgcccgcctggatcgcggggcaggaccgcgagcggttcaggatcgattag

DBGET integrated database retrieval system