Pseudoblastomonas marina: T8S45_10350
Help
Entry
T8S45_10350 CDS
T09636
Name
(GenBank) copper resistance protein B
KO
K07233
copper resistance protein B
Organism
bmaa
Pseudoblastomonas marina
Brite
KEGG Orthology (KO) [BR:
bmaa00001
]
09190 Not Included in Pathway or Brite
09193 Unclassified: signaling and cellular processes
99994 Others
T8S45_10350
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CopB
Motif
Other DBs
NCBI-ProteinID:
WPZ03234
LinkDB
All DBs
Position
2096965..2098278
Genome browser
AA seq
437 aa
AA seq
DB search
MKIRIASLLASAAASSILASPAAAQHAGHSSAEAQQSAEAQADPDTKCEEEAERHRAMGH
SVADGACEPAAQPEAAMDRSQMDHSTMDHGSMTAQDGHSGMTMPMDAARPQASPESHEGM
DHGSMPQGKPAEGAMDHSQMNHGEMGQAEASSSMDHGQMDHSQMNHGQTPSQDRQGMDHS
AMQMGSDDDIPLLPPPPEAGSGPARAAVAIWGEEAMNEARRELVRETDGGMRFWFQGDRL
EYRAREGKDGYLWDIQGYYGGDIDKFWFKSEGEGSFGEPVEGAEVQALWSRAIAPFFDFQ
AGVRQDLTGPERTHAVIGIQGLMPYRFEVDAAAFVSTKGDVTARIEGELDQRITQRLILQ
PRAELALSAQDIPELGIGAGLDRIEAGLRLRYEFAREFAPYVGVSQEWRIGDSADFARAA
GEDPSVTNYVVGVRFWF
NT seq
1314 nt
NT seq
+upstream
nt +downstream
nt
atgaaaattcgtattgccagcctgctcgcatcggccgcagccagctcaattctcgcctcc
cccgcggcggcgcagcatgccggtcattcgtcggcggaagcgcagcaaagcgccgaggcg
caggctgaccccgatacaaagtgcgaggaagaagccgagcgccatcgcgcgatggggcat
tcggtagcagatggagcatgcgaaccggctgcacagcctgaagccgccatggaccgctcg
cagatggatcactcaaccatggatcatggttcgatgaccgctcaggatggccattctggc
atgacaatgccaatggacgctgcccgtccacaggcatcgcccgaaagtcatgaaggaatg
gatcacggctcgatgccgcagggcaagcccgccgaaggcgcgatggatcattcgcagatg
aatcacggcgagatgggacaggcggaggccagttcgtcgatggaccatgggcagatggat
cacagccagatgaaccatgggcagacgccttcgcaggacaggcagggcatggaccattcg
gcgatgcagatgggctcggacgatgatatcccgctgctgccgcctcctccagaagcaggg
agcggcccagcgcgcgcggcggtcgccatctggggcgaggaagccatgaacgaagcgcgc
cgcgagcttgtccgcgagaccgacggaggaatgcgcttctggtttcagggcgaccggctc
gaataccgcgcccgcgaggggaaggatggatatctgtgggacatccagggatattatggc
ggcgacatcgacaaattctggttcaagtccgagggtgagggcagcttcggcgaacccgta
gaaggcgccgaggtccaggcgctctggagtcgcgccattgcgcccttcttcgatttccag
gcgggtgttcgccaggacctcaccggtccggagcgcacgcacgcggttatcggtatccag
ggtctcatgccgtaccgcttcgaggtcgatgccgcggccttcgtctccaccaagggcgat
gtgaccgcgcgtatcgagggcgaactcgatcagcgcatcacgcagcggttgatcctccag
cccagagccgaactcgcgctttctgcgcaggacattcccgagctgggcatcggtgccggg
ctcgatcggatcgaggcaggtttgcgtcttcgctacgagttcgcacgcgaattcgcgccc
tatgtcggcgtttcccaggaatggcgcatcggcgacagcgcggattttgcgcgggccgcc
ggagaggatccgagcgtcaccaattatgtcgtcggtgtgcgattctggttctga
DBGET
integrated database retrieval system