KEGG   Burkholderia mallei 2002734299: BM45_1520
Entry
BM45_1520         CDS       T03872                                 
Symbol
thrC
Name
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bmab  Burkholderia mallei 2002734299
Pathway
bmab00260  Glycine, serine and threonine metabolism
bmab00750  Vitamin B6 metabolism
bmab01100  Metabolic pathways
bmab01110  Biosynthesis of secondary metabolites
bmab01120  Microbial metabolism in diverse environments
bmab01230  Biosynthesis of amino acids
Module
bmab_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bmab00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BM45_1520 (thrC)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BM45_1520 (thrC)
Enzymes [BR:bmab01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BM45_1520 (thrC)
SSDB
Motif
Pfam: Thr_synth_N PALP THR4_C
Other DBs
NCBI-ProteinID: AJX03282
UniProt: A0AAX1X4A2
LinkDB
Position
1:1659987..1661438
AA seq 483 aa
MNYISTRGAGIGERHTFSDILLGGLAKDGGLYLPSEYPRVSADELARWRALPYADLAFEI
LAKFCDDIPADDLRAITRRTYTADVYRHTRHGGNAADITPLTTLGAENGAPVSLLELSNG
PTLAFKDMAMQLLGNLFEYTLAAHGETLNILGATSGDTGSAAEYAMRGKRGVRVFMLSPH
RKMSAFQTAQMYSLQDPNIFNLAVKGVFDDCQDIVKAVSNDHAFKAQQKIGTVNSINWAR
VVAQVVYYFKGYFAATRTNDERVSFTVPSGNFGNVCAGHIARMMGLPIEKLVVATNENDV
LDEFFRTGAYRVRSAEHTYHTSSPSMDISKASNFERFVFDLLGRDPARVVQLFRDVEQKG
GFDLAASGDFARVAEFGFVSGRSTHADRLATIRDVFERYRTTIDTHTADGLKVAREHLQP
GVPMIVLETAQPIKFGETIREALGREPSRPAAFDGLEALPQRFEVVDASAQQVKDFIAAH
TGA
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgaattacatctccacgcgcggcgccggcatcggcgagcgtcacacgttctccgacatc
ctgctcggcggcctcgcgaaggacggcgggctctacctgccgagcgagtatccgcgggtg
agcgcggacgagctcgcgcgctggcgcgcgctgccgtacgcggatctcgcgttcgagatc
ctcgcgaagttctgcgacgacatcccggccgacgacctgcgcgcgatcacgcgccgcacg
tatacggccgacgtctatcgtcacacgcgccacggcggcaacgcggccgacatcacgccg
ctcacgacgctcggtgccgagaacggcgcgccggtctcgctgctcgaactgtcgaacggc
ccgacgctcgcgttcaaggacatggcgatgcagttgctcggcaacctgttcgagtacacg
ctcgccgcgcacggcgaaacgctgaacatcctcggcgcgacgtcgggcgatacgggcagc
gcggccgaatacgcgatgcgcggcaagcggggcgtgcgcgtgttcatgctgtcgccgcac
cggaagatgagtgcgttccagacggcccagatgtacagcctgcaggacccgaacatcttc
aacctcgcggtgaagggcgtgttcgacgattgccaggacatcgtgaaggccgtgtcgaac
gatcacgcgttcaaggcgcagcagaagatcggcacggtcaattcgatcaactgggcgcgt
gtcgtcgcgcaggtcgtgtactacttcaagggctatttcgcggcgacgcgcacgaacgac
gagcgcgtgtcgtttacggtgccgtcgggcaacttcggcaatgtctgcgcgggccacatc
gcgcggatgatggggctgccgatcgagaagctcgtcgtcgcgaccaacgagaacgacgtg
ctcgacgaattcttccgcacgggtgcgtatcgcgtgcgcagcgccgagcacacgtaccac
acgagcagcccgagcatggacatctcgaaggcgtcgaacttcgagcgcttcgtgttcgac
ctgctcggccgcgatccggcgcgcgtcgttcagctgtttcgcgacgtcgagcaaaagggt
ggcttcgatctcgcggcgagcggcgatttcgcgcgcgtcgccgagttcggcttcgtgtcg
ggccgcagcacgcacgcggaccggctcgcgacgatccgcgacgtgttcgagcgctatcgc
acgacgatcgacacgcacacggccgacggcctgaaagtggcgcgcgagcatctgcagccg
ggcgtgccgatgatcgtgctcgagaccgcgcagccgatcaagttcggcgaaacgattcgc
gaggcgctcgggcgggagccgtcgcggcccgccgcgttcgacgggctcgaggcgttgccg
cagcgcttcgaggtggtcgacgcgagcgcgcagcaggtgaaggacttcatcgccgcgcac
acgggcgcatga

DBGET integrated database retrieval system