Burkholderia mallei 2002734299: BM45_2818 Help Entry BM45_2818         CDS       T03872                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism bmab  Burkholderia mallei 2002734299 Pathway bmab00190   Oxidative phosphorylation bmab01100   Metabolic pathways bmab02020   Two-component system Module bmab_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:bmab00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     BM45_2818  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     BM45_2818 Enzymes [BR:bmab01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      BM45_2818 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AJX02607 UniProt:  A0AAX1X7S8 LinkDB All DBs Position 1:3107110..3107208 Genome browser AA seq 32 aa AA seqDB search MWYFSWILGIGVALAFGIINAMWLEARQKRDA NT seq 99 nt NT seq  +upstreamnt  +downstreamnt atgtggtacttcagctggattctcggcatcggcgtcgcgctcgcgttcggcatcatcaat gcgatgtggctcgaagcgcggcaaaagcgcgacgcgtag

DBGET integrated database retrieval system