Burkholderia mallei 2002734299: BM45_4369 Help Entry BM45_4369         CDS       T03872                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bmab  Burkholderia mallei 2002734299 Brite KEGG Orthology (KO) [BR:bmab00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bmab03036]     BM45_4369    03400 DNA repair and recombination proteins [BR:bmab03400]     BM45_4369 Chromosome and associated proteins [BR:bmab03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BM45_4369 DNA repair and recombination proteins [BR:bmab03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BM45_4369 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  AJX05610 UniProt:  A0AAX1X9Y6 LinkDB All DBs Position 2:1527949..1528248 Genome browser AA seq 99 aa AA seqDB search MSTYLELKAKADEILRQAEEARRSELETVLKEVRTRVAEYGLTPEQVFGARRGRRGQQVH ASPTVPKYRDPKTGATWSGRGREPGWIKGKKRERFLIQQ NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgagtacttatctcgaattgaaagccaaagccgatgagatcctgcgtcaggcagaagaa gcgagacgctcggaactcgagacggtcttgaaggaagttcgcacgcgcgtcgcggaatac ggattgacgccggaacaggtattcggcgcgcgccgcgggcgacgcggccaacaggtgcat gccagtccgacggttcccaaataccgcgacccgaaaacgggggcgacctggagcggccgg gggcgcgaaccgggctggatcaagggcaagaaacgcgagcgcttcctgattcagcagtaa

DBGET integrated database retrieval system