Bartonella machadoae: LNM86_07380 Help Entry LNM86_07380       CDS       T08469                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bmac  Bartonella machadoae Pathway bmac01100   Metabolic pathways bmac01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bmac00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LNM86_07380    00074 Mycolic acid biosynthesis     LNM86_07380   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LNM86_07380 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Delta_lysin Motif Other DBs NCBI-ProteinID:  UNE53493 LinkDB All DBs Position complement(1514810..1515046) Genome browser AA seq 78 aa AA seqDB search MSDTVERVKKIIVEHLGVNADKVVENASFIDDLGADSLDTVELVMAFEEEFGVEIPDEAA ETIFTVGDAVKFIDKAST NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgatacagtagagcgcgttaagaaaattatcgtggagcatcttggagttaatgca gataaggtggtagagaatgcaagctttatcgatgatctaggagcagatagccttgataca gttgagcttgttatggcttttgaagaagaatttggtgtagaaataccagatgaggccgct gaaacgattttcacagtgggtgatgcagtaaagtttatcgataaggcttctacataa

DBGET integrated database retrieval system