Burkholderia mallei 6: DM78_2581 Help Entry DM78_2581         CDS       T03489                                  Name (GenBank) chaperonin 10 Kd subunit   KO K04078   chaperonin GroES Organism bmae  Burkholderia mallei 6 Brite KEGG Orthology (KO) [BR:bmae00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:bmae03110]     DM78_2581    03029 Mitochondrial biogenesis [BR:bmae03029]     DM78_2581 Chaperones and folding catalysts [BR:bmae03110]  Heat shock proteins   HSP10    DM78_2581 Mitochondrial biogenesis [BR:bmae03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     DM78_2581 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 ExoX-like_C Motif Other DBs NCBI-ProteinID:  AIO59375 UniProt:  A0AAX1X225 LinkDB All DBs Position 1:complement(2875636..2875929) Genome browser AA seq 97 aa AA seqDB search MNLRPLHDRVIVKRLDQETKTASGIVIPDAAAEKPDQGEVLAIGPGKRDDKGAPIALDVK VGDRVLFGKYAGQTVKVDGQELLVMREEDIMAVVNAK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaaccttcgtccgttgcacgatcgcgtgatcgtcaagcgcctggatcaggaaaccaag accgcctcgggcatcgtcattcccgacgcagccgctgagaagccggatcaaggcgaagtc ctggccatcggcccgggcaagcgcgatgacaagggcgctccgatcgcactcgacgtgaag gtcggcgatcgtgttctgtttggcaagtacgctggccaaaccgtcaaggtcgacggccag gaactgctcgtgatgcgcgaagaagacatcatggccgtggtcaacgctaagtaa

DBGET integrated database retrieval system