Burkholderia mallei 6: DM78_3255
Help
Entry
DM78_3255 CDS
T03489
Name
(GenBank) bacterial regulatory s, luxR family protein
Organism
bmae
Burkholderia mallei 6
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
GerE
TadZ_N
Sigma70_r4
HTH_23
Sigma70_r4_2
DUF3071
HTH_31
HTH_29
Terminase_5
HTH_38
HTH_7
Motif
Other DBs
NCBI-ProteinID:
AIO56290
UniProt:
A0AAQ0QSN4
LinkDB
All DBs
Position
2:complement(102103..102750)
Genome browser
AA seq
215 aa
AA seq
DB search
MIKVLIADDHALVRDGLRHILQNASGYEVAGEAFDSATTIALVRSTPAQVLVLDLSMPGR
NGVELIKQIKEEKPALRILVLTMHAEQQYAVRAFRAGASGYLTKESASSELVGAVTKVAS
GGVYVSLAMAERFAQSLNEPAETLPHHRLSDREFDVFRRIASGQTLTQIADELCVSAKTV
STYKTRILEKMQMPHEAALVRYALRHKLIDDPDED
NT seq
648 nt
NT seq
+upstream
nt +downstream
nt
atgatcaaggttctgattgccgacgaccacgcgctcgtgcgcgacggtctgcgccatatc
ctgcagaatgcgtccggctacgaagtcgccggtgaagcgttcgacagcgcgacgacgatc
gcgctcgtgcgctcgacgcccgcgcaagtgctcgtgctcgatctgtcgatgccgggccgc
aacggcgtcgagctgatcaagcagatcaaggaggagaagcccgcgctgcggatcctggtg
ctgacgatgcatgcggagcagcagtacgcggtgcgcgcgttccgcgcgggcgcctccggc
tatctgacgaaggagagcgcgagctcggagctcgtcggcgcggtgacgaaggtcgcctcg
ggcggcgtctacgtgagcctcgcgatggccgagcgcttcgcgcagagcctgaacgaaccg
gcggagacgctgccgcaccaccggctgtcggaccgcgagttcgacgtgttccgccggatc
gcctccggccagacgctcacgcagatcgccgacgagctgtgcgtgagcgcgaagacggtc
agcacgtacaagacgcggattctcgagaagatgcagatgccgcacgaagcggcgctcgtg
cgctacgcgttgcggcacaagctgatcgacgatccggacgaggattga
DBGET
integrated database retrieval system