Burkholderia mallei 6: DM78_3267 Help Entry DM78_3267         CDS       T03489                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bmae  Burkholderia mallei 6 Brite KEGG Orthology (KO) [BR:bmae00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bmae03036]     DM78_3267    03400 DNA repair and recombination proteins [BR:bmae03400]     DM78_3267 Chromosome and associated proteins [BR:bmae03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     DM78_3267 DNA repair and recombination proteins [BR:bmae03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       DM78_3267 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS DUF6376 Motif Other DBs NCBI-ProteinID:  AIO56292 LinkDB All DBs Position 2:116005..116295 Genome browser AA seq 96 aa AA seqDB search MATYKELLAQLDDLKQQAKRARALELPDVLVGLRKKIVEYGLSQKDLFPPRLGRPKKADA LPKPRYRDPDTGATWTGRGRAPAWIAGQDRERFRID NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcaacatacaaggaattgcttgcccaattggatgatttgaagcagcaggcgaagcgc gcccgcgcgctcgagttgcccgacgtgctcgtcgggttgcgcaagaagatcgtcgaatac ggtctctcgcagaaagacctgtttccgcctcgcctcggacggccgaagaaagccgacgcg ctgccgaagccgcgctatcgcgatccggacacgggcgcgacatggacggggcgcggccgc gcgcccgcctggatcgcggggcaggaccgcgagcggttcaggatcgattag

DBGET integrated database retrieval system