Burkholderia mallei 6: DM78_815 Help Entry DM78_815          CDS       T03489                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bmae  Burkholderia mallei 6 Brite KEGG Orthology (KO) [BR:bmae00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bmae03036]     DM78_815    03400 DNA repair and recombination proteins [BR:bmae03400]     DM78_815 Chromosome and associated proteins [BR:bmae03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     DM78_815 DNA repair and recombination proteins [BR:bmae03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       DM78_815 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS YL1_C ROS_MUCR Rootletin Motif Other DBs NCBI-ProteinID:  AIO58629 UniProt:  A0AAX1X816 LinkDB All DBs Position 1:897784..898080 Genome browser AA seq 98 aa AA seqDB search MSQYAKIKAQIVELQAQAEEVRRQEIAAVVAELQGKIAEYGLTAQDLGFAERARRGRPPK KGPLPAKYRDPKSGNTWSGRGKPPHWIVGKNRERFLIG NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtctcaatacgcgaaaatcaaggcgcagatcgtggagctgcaagcccaggccgaagaa gtacgtcgtcaggaaatcgcggccgtggtcgccgagttgcaaggcaagatcgccgagtac gggctcacggcgcaggacttggggttcgccgagcgggcgcggcgcggccggccgccgaag aagggcccgctgcccgccaagtaccgcgatccgaaatccggcaacacgtggagcggccgc ggcaagcccccgcattggatcgtcggcaaaaaccgcgagcgctttttgatcggctga

DBGET integrated database retrieval system