Burkholderia mallei FMH 23344: DM51_623 Help Entry DM51_623          CDS       T03523                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bmaf  Burkholderia mallei FMH 23344 Brite KEGG Orthology (KO) [BR:bmaf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bmaf03036]     DM51_623    03400 DNA repair and recombination proteins [BR:bmaf03400]     DM51_623 Chromosome and associated proteins [BR:bmaf03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     DM51_623 DNA repair and recombination proteins [BR:bmaf03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       DM51_623 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  AIP77814 UniProt:  A0AAX1X395 LinkDB All DBs Position 1:complement(694898..695179) Genome browser AA seq 93 aa AA seqDB search METYLDLLAEREALMIKLDAARMQARSAALSEVKRIVEEFELTTQEVFGRAGVLRRRGKL KPKYRDPKTGATWNGRGRPPSWIAGKDRAAFVA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggaaacctacctcgaccttctggccgaacgagaagccctgatgatcaagctggatgcg gcgcgcatgcaggcgcgcagcgccgcgctatccgaagtgaagcgaatcgtcgaggaattc gaactcacgacgcaggaagtgttcggccgcgcgggcgtgctgcgccgtcgcggcaagctc aagccgaagtatcgcgatccgaaaaccggcgcgacctggaacggccgcggccgcccgcct tcgtggatcgccggaaaggatcgcgccgcgttcgtcgcttga

DBGET integrated database retrieval system