Burkholderia mallei 2000031063: DM57_08305 Help Entry DM57_08305        CDS       T03522                                  Name (GenBank) H-NS histone   KO K03746   DNA-binding protein H-NS Organism bmai  Burkholderia mallei 2000031063 Brite KEGG Orthology (KO) [BR:bmai00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bmai03036]     DM57_08305    03400 DNA repair and recombination proteins [BR:bmai03400]     DM57_08305 Chromosome and associated proteins [BR:bmai03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     DM57_08305 DNA repair and recombination proteins [BR:bmai03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       DM57_08305 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS HalX Motif Other DBs NCBI-ProteinID:  AIW48027 UniProt:  A0AAX1XDX4 LinkDB All DBs Position 2:762090..762380 Genome browser AA seq 96 aa AA seqDB search MATYKELKARAEALSAQAEAARQAELQAAIEDVRAKVREYGLTAYDVFGHRKKPGERHRG AVRPKYRDPATGATWTGRGIEPKWIRGRNRDEFLIE NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcgacatacaaggaactgaaggctcgggccgaggcgctgagcgcgcaggccgaagcg gcgcggcaggctgaattgcaggccgcgatcgaagacgtgcgcgcgaaggtgcgcgagtac ggtctcacggcgtacgacgtgttcggacaccgaaagaagccgggcgagcgccatcgcggg gcggtcaggccgaagtaccgcgatccggcgacgggcgcgacctggaccggacgcggcatc gagccgaaatggatccggggccgtaatcgggacgaattcctgatcgaatga

DBGET integrated database retrieval system