Burkholderia mallei 2000031063: DM57_1738 Help Entry DM57_1738         CDS       T03522                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism bmai  Burkholderia mallei 2000031063 Brite KEGG Orthology (KO) [BR:bmai00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bmai03032]     DM57_1738    03036 Chromosome and associated proteins [BR:bmai03036]     DM57_1738    03400 DNA repair and recombination proteins [BR:bmai03400]     DM57_1738 DNA replication proteins [BR:bmai03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     DM57_1738 Chromosome and associated proteins [BR:bmai03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     DM57_1738 DNA repair and recombination proteins [BR:bmai03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       DM57_1738 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF937 HU-CCDC81_euk_1 HU-CCDC81_euk_2 DUF2267 Motif Other DBs NCBI-ProteinID:  AIO80462 UniProt:  A0AAX1X8B7 LinkDB All DBs Position 1:complement(1598398..1598676) Genome browser AA seq 92 aa AA seqDB search MNKQELIDAVAAQTGASKAQTGETLDTLLEVIKKAVSKGDSVQLIGFGSFGSGKRAARTG RNPKTGETIKIPAAKTVKFTAGKAFKDAVNKR NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaggaactgatcgacgccgtcgccgcccagacgggcgccagcaaggctcaa accggcgaaacgctggacacgctcctcgaagtgatcaagaaggctgtgtcgaaaggcgac tcagttcaactgatcggcttcggcagcttcggctcgggcaagcgcgcagcgcgcaccggc cgcaaccccaagacgggcgagaccatcaagatcccggcagccaagacggtcaagttcacg gctggcaaggcgttcaaggacgcagtgaacaagcgctga

DBGET integrated database retrieval system