KEGG   Burkholderia mallei 2000031063: DM57_2261
Entry
DM57_2261         CDS       T03522                                 
Name
(GenBank) arabinose transporter permease
  KO
K19577  MFS transporter, DHA1 family, inner membrane transport protein
Organism
bmai  Burkholderia mallei 2000031063
Brite
KEGG Orthology (KO) [BR:bmai00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmai02000]
    DM57_2261
Transporters [BR:bmai02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    DM57_2261
SSDB
Motif
Pfam: MFS_1 Sugar_tr MFS_4 MFS_2 Vel1p
Other DBs
NCBI-ProteinID: AIO79467
UniProt: A0AAX1X9D9
LinkDB
Position
1:complement(1015428..1016600)
AA seq 390 aa
MPLPLLALAISAFAIGTTEFVIMGLLPDIARELAVTLPSAGLLVSGYALGVAAGAPLLAV
LTSRMPRKAALQLLMAIFIAGNVLCALAQSYGMLMVARVVTSFAHGSFFGIGAVVAASLV
SADKRASAIALMFTGLTLANVLGVPFGTFVGQTLGWRATFWIVAALGVASFAGVAALVPK
RRDAAGAALSRELRVLRQPQVWLALAMTVLGFGGVFVVFTYIAPILEDVTGFAPRAVSLV
LVLFGAGLTIGNTIGGRLADRALMPSLVAILVALIAVMAAFAKTSHMPAAAAVTVFVWGI
AAFATVPPLQSRVVEKAAHAPNLASTLNIGAFNVGNAGGAWLGGVALSHGVPLDALPWVA
AVVTLAALAVTALAARLDTRVSSGAATAAQ
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgcctctaccgttactcgcgctcgcgatcagcgcgttcgccatcggcaccaccgagttc
gtcatcatgggcctgttgcccgacatcgcgcgcgagctcgccgtcacgctgccgtccgcc
ggccttctcgtgagcggctacgcgctcggcgtcgccgcgggcgcgccgctgctcgccgtg
ctgacgagccgcatgccgcgcaaggccgcgttgcagctgctgatggcgatcttcatcgcc
ggcaacgtgctgtgcgcgctcgcgcagagctacgggatgctgatggtcgcgcgcgtcgtc
acgtcgttcgcgcacggttcgtttttcggcatcggcgcggtggtcgccgcatcgctcgtg
agcgccgacaagcgcgcgagcgcgatcgcgctgatgttcacggggctcacgctcgcgaac
gtgctcggcgtgccgttcggtaccttcgtcggccagacgctcggctggcgcgcgacgttc
tggatcgtcgcggcgctcggtgtcgcgtcgttcgccggcgtcgccgcgctcgtgccgaaa
cggcgcgacgcggcgggcgcggcgcttagccgcgagctgcgcgtgctcaggcagccgcag
gtgtggctcgcgctcgcgatgacggtgctcggtttcggcggcgtattcgtcgtgttcacc
tacatcgcgccgattctcgaggatgtgacgggcttcgcgccgcgtgcggtgtcgctcgtg
ctcgtgctgttcggcgccgggctcacgatcggcaacacgatcggcggccggctcgcggac
cgcgcgctgatgccttcgctggtcgcgattctcgtcgcgctgatcgccgtgatggcggcg
ttcgcgaagacgagccacatgcccgccgcggccgccgtcaccgtatttgtctgggggatc
gctgcttttgcgacggttcctccgctacagtcgcgggtcgtcgagaaggccgcgcatgcg
ccgaatctcgcgtcgacgctgaacatcggggcgttcaacgtcggcaatgcgggcggcgcg
tggctgggcggcgtcgcgctgtcgcacggggtgccgctcgacgcgctgccttgggtggcg
gccgtcgtcacgctcgccgcgctcgccgtcacggcgctcgccgcgcggctcgatacgcgc
gtctcatcgggcgcggctacagcggcgcaatga

DBGET integrated database retrieval system